@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu14060: (2016-06-21 )
MEKKAVIITGGSSGMGKAMAKKQAELGWHVMVTGRNHEALEETKKEIQTFEGQVACFQMDVRSDSAASDMIKEAVKAFGRLDALINNAAGNFICPAEKLTPNGWKAVIEIVLNGTFFCSQAAARHWIDQKQQGVILNMAATYAWGAGAGVVHSAAAKAGVLSLTRTLAVEWGSKYGIRTNAIAPGPIERTGGAEKLFESEKAMARTMNSVPLGRLGTPEEIAALAAFLLSDEASYINGDCITMDGGQWLNPYPF

Atome Classification :

(26 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HXC_A_6(4FC6)
DECR2_HUMAN
[Raw transfer]




HXC_D_12(4FC6)
DECR2_HUMAN
[Raw transfer]




HXC_C_9(4FC6)
DECR2_HUMAN
[Raw transfer]




HXC_B_8(4FC6)
DECR2_HUMAN
[Raw transfer]




COA_D_12(4FC7)
DECR2_HUMAN
[Raw transfer]




COA_B_8(4FC7)
DECR2_HUMAN
[Raw transfer]




COA_A_6(4FC7)
DECR2_HUMAN
[Raw transfer]




COA_C_10(4FC7)
DECR2_HUMAN
[Raw transfer]




NAP_A_6(1W73)
DECR_HUMAN
[Raw transfer]




NAP_A_6(1W8D)
DECR_HUMAN
[Raw transfer]




HXC_D_12(1W6U)
DECR_HUMAN
[Raw transfer]




HXC_A_6(1W6U)
DECR_HUMAN
[Raw transfer]




HXC_B_8(1W6U)
DECR_HUMAN
[Raw transfer]




HXC_C_10(1W6U)
DECR_HUMAN
[Raw transfer]




EDO_C_26(3RIH)
?
[Raw transfer]




118 HHSearch 86.3966%-105 - C1 -3IMF - ? -
1 PsiBlast_PDB 85.1263%-105 - C1 -3IMF - ? -
31 PsiBlast_CBE 75.4337%-119 - C1 -4FC6 5.5 DECR2_HUMAN
6 PsiBlast_PDB 74.5837%-117 - C1 -4FC6 4.0 DECR2_HUMAN
28 PsiBlast_CBE 73.7937%-117 - C1 -4FC7 5.6 DECR2_HUMAN
27 PsiBlast_CBE 73.0737%-114 - C1 -4FC7 6.6 DECR2_HUMAN
29 PsiBlast_CBE 73.0137%-117 - C1 -4FC6 5.7 DECR2_HUMAN
26 PsiBlast_CBE 72.5137%-116 - C1 -4FC7 6.2 DECR2_HUMAN
30 PsiBlast_CBE 71.9937%-115 - C1 -4FC6 6.1 DECR2_HUMAN
7 PsiBlast_PDB 71.5737%-115 - C1 -4FC7 6.7 DECR2_HUMAN
73 PsiBlast_CBE 70.9234%-108 - C1 -3RIH - ? -
24 PsiBlast_CBE 70.7934%-114 - C1 -1YXM - PECR_HUMAN -
71 PsiBlast_CBE 70.7534%-107 - C1 -3RIH 2.7 ?
70 PsiBlast_CBE 68.2734%-104 - C1 -3RIH - ? -
63 PsiBlast_CBE 67.9936%-103 - C1 -3PK0 - ? -
72 PsiBlast_CBE 67.9734%-108 - C1 -3RIH - ? -
62 PsiBlast_CBE 67.8636%-105 - C1 -3PK0 - ? -
25 PsiBlast_CBE 67.8534%-115 - C1 -1YXM - PECR_HUMAN -
104 PsiBlast_CBE 67.7933%-116 - C1 -4NBV - ? -
61 PsiBlast_CBE 67.6436%-105 - C1 -3PK0 - ? -
2 PsiBlast_PDB 56.2341%-109 - C1 -1W6U 6.2 DECR_HUMAN
3 PsiBlast_PDB 56.1941%-110 - C1 -1W73 9.4 DECR_HUMAN
4 PsiBlast_PDB 55.0441%-107 - C1 -1W8D 9.0 DECR_HUMAN
22 PsiBlast_CBE 53.4741%-102 - C1 -1W6U 5.1 DECR_HUMAN
23 PsiBlast_CBE 52.2041%-111 - C1 -1W6U 6.4 DECR_HUMAN
21 PsiBlast_CBE 49.3641%-111 - C1 -1W6U 5.2 DECR_HUMAN