@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu14150: (2016-06-22 )
MAKALITYASMSGNTEDIAFIIKDTLQEYELDIDCVEINDMDASCLTSYDYVLIGTYTWGDGDLPYEAEDFFEEVKQIQLNGLKTACFGSGDYSYPKFCEAVNLFNVMLQEAGAAVYQETLKIELAPETDEDVESCRAFARGFLAWADYMNKEKIHVS

Atome Classification :

(31 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_A_3(4HEQ)
FLAV_DESGI
[Raw transfer]




FMN_B_4(4HEQ)
FLAV_DESGI
[Raw transfer]




FMN_B_2(1WSB)
FLAV_DESVH
[Raw transfer]




FMN_B_2(1J8Q)
FLAV_DESVH
[Raw transfer]




FMN_A_2(1J9E)
FLAV_DESVH
[Raw transfer]




FMN_B_2(1FX1)
FLAV_DESVH
[Raw transfer]




FMN_A_3(4HEQ)
FLAV_DESGI
[Raw transfer]




FMN_B_2(1AKR)
FLAV_DESVH
[Raw transfer]




FMN_B_2(1AKT)
FLAV_DESVH
[Raw transfer]




FMN_B_2(1J9G)
FLAV_DESVH
[Raw transfer]




FMN_B_2(1AKW)
FLAV_DESVH
[Raw transfer]




FMN_B_6(3F6R)
FLAV_DESDE
[Raw transfer]




FMN_C_3(1XYY)
FLAV_DESVH
[Raw transfer]




FMN_B_2(1XYV)
FLAV_DESVH
[Raw transfer]




FMN_C_3(1WSW)
FLAV_DESVH
[Raw transfer]




FMN_A_5(3F6R)
FLAV_DESDE
[Raw transfer]




RBF_E_5(1BU5)
FLAV_DESVH
[Raw transfer]




51 PsiBlast_CBE 86.5335%-132 - C1 -3KAQ - FLAW_DESDA -
42 PsiBlast_CBE 85.4136%-139 - C1 -3F6S - FLAV_DESDE -
31 PsiBlast_CBE 85.1436%-140 - C1 -3F90 - FLAV_DESDE -
43 PsiBlast_CBE 84.6636%-137 - C1 -3F6S - FLAV_DESDE -
21 PsiBlast_CBE 84.5937%-127 - C1 -4HEQ 10.6 FLAV_DESGI
37 PsiBlast_CBE 84.4736%-142 - C1 -3F6S - FLAV_DESDE -
39 PsiBlast_CBE 84.4336%-137 - C1 -3F6S - FLAV_DESDE -
47 PsiBlast_CBE 84.4136%-142 - C1 -3F6R 3.9 FLAV_DESDE
33 PsiBlast_CBE 84.2636%-134 - C1 -3F90 - FLAV_DESDE -
36 PsiBlast_CBE 84.2536%-140 - C1 -3F90 - FLAV_DESDE -
35 PsiBlast_CBE 84.1336%-137 - C1 -3F90 - FLAV_DESDE -
52 PsiBlast_CBE 83.8235%-135 - C1 -3KAP - FLAW_DESDA -
29 PsiBlast_CBE 83.7836%-141 - C1 -3F90 - FLAV_DESDE -
81 HHSearch 83.7338%-138 - C1 -4HEQ 10.8 FLAV_DESGI
32 PsiBlast_CBE 83.6236%-142 - C1 -3F90 - FLAV_DESDE -
45 PsiBlast_CBE 83.3336%-144 - C1 -3F6R - FLAV_DESDE -
7 PsiBlast_PDB 83.3138%-118 - C1 -1XYY 9.6 FLAV_DESVH
48 PsiBlast_CBE 83.3036%-143 - C1 -3F6R 8.3 FLAV_DESDE
1 PsiBlast_PDB 83.0437%-126 - C1 -4HEQ 10.8 FLAV_DESGI
38 PsiBlast_CBE 83.0336%-146 - C1 -3F6S - FLAV_DESDE -
4 PsiBlast_PDB 82.9938%-113 - C1 -1WSB 10.4 FLAV_DESVH
5 PsiBlast_PDB 81.3638%-117 - C1 -1WSW 10.0 FLAV_DESVH
14 PsiBlast_PDB 81.0437%-116 - C1 -1J9G 10.2 FLAV_DESVH
6 PsiBlast_PDB 81.0238%-113 - C1 -1XYV 8.5 FLAV_DESVH
2 PsiBlast_PDB 80.6037%-118 - C1 -1J9E 10.8 FLAV_DESVH
9 PsiBlast_PDB 79.7937%-107 - C1 -1J8Q 10.7 FLAV_DESVH
8 PsiBlast_PDB 79.4636%-126 - C1 -1FX1 8.4 FLAV_DESVH
20 PsiBlast_PDB 77.6735%-113 - C1 -1AKR 9.7 FLAV_DESVH
28 PsiBlast_CBE 77.0435%-115 - C1 -1AKT 9.7 FLAV_DESVH
50 PsiBlast_CBE 76.8935%-114 - C1 -1AKW 10.1 FLAV_DESVH
16 PsiBlast_PDB 72.6936%-115 - C1 -1BU5 7.8 FLAV_DESVH