@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu14560: (2016-06-22 )
MITMENIVRDGHPALRETAEPVELPPTDAEKQQLADMIEFVKNSQNPELAEKYKLRPGVGLAAPQINIKKRMIAVHAEDASGKLYSYALFNPKIVSHSVEKSYLTSGEGCLSVDEAIPGYVPRYARIRVKGTTLEGENIDIRLKGFPAIVFQHEIDHLNGVMFYDHIDKENPFKEPENAIAIER

Atome Classification :

(54 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BB2_A_4(1LQY)
DEF2_GEOSE
[Raw transfer]




BB2_A_5(2OKL)
DEF2_BACCR
[Raw transfer]




BB2_B_7(2OKL)
DEF2_BACCR
[Raw transfer]




BB2_A_6(2OS1)
DEF_ENTFA
[Raw transfer]




BB2_A_3(2OS3)
DEF_STRP1
[Raw transfer]




BB2_A_5(3UWB)
?
[Raw transfer]




BB2_A_3(1LRY)
DEF_PSEAE
[Raw transfer]




EPE_B_6(1VEY)
DEF_LEPIN
[Raw transfer]




SB8_A_4(2AIA)
DEF_STRR6
[Raw transfer]




BB2_A_5(3U04)
?
[Raw transfer]




BB2_C_10(4WXL)
DEF_HAEI8
[Raw transfer]




SB7_A_4(2AI7)
DEF_STRR6
[Raw transfer]




BB2_B_7(1IX1)
DEF_PSEAE
[Raw transfer]




BB2_A_5(1IX1)
DEF_PSEAE
[Raw transfer]




GNR_B_6(1S17)
DEF_PSEAE
[Raw transfer]




BB2_D_12(4WXL)
DEF_HAEI8
[Raw transfer]




BB2_A_6(4WXL)
DEF_HAEI8
[Raw transfer]




SB9_P_4(2AIE)
DEF_STRR6
[Raw transfer]




GNR_A_5(1S17)
DEF_PSEAE
[Raw transfer]




EPE_A_5(1VEY)
DEF_LEPIN
[Raw transfer]




5LI_P_4(3SW8)
?
[Raw transfer]




FMT_A_8(1VEV)
DEF_LEPIN
[Raw transfer]




FMT_A_13(1Y6H)
DEF_LEPIN
[Raw transfer]




MES_B_6(1VEV)
DEF_LEPIN
[Raw transfer]




FMT_A_13(1Y6H)
DEF_LEPIN
[Raw transfer]




GOL_A_7(1N5N)
DEF_PSEAE
[Raw transfer]




FMT_A_12(1VEZ)
DEF_LEPIN
[Raw transfer]




BB2_B_8(4WXL)
DEF_HAEI8
[Raw transfer]




GOL_C_10(4WXK)
DEF_HAEI8
[Raw transfer]




BRR_A_5(1RL4)
?
[Raw transfer]




GOL_A_5(1N5N)
DEF_PSEAE
[Raw transfer]




FMT_B_18(1VEZ)
DEF_LEPIN
[Raw transfer]




GOL_A_7(1N5N)
DEF_PSEAE
[Raw transfer]




GOL_A_6(4WXK)
DEF_HAEI8
[Raw transfer]




MES_A_5(1VEV)
DEF_LEPIN
[Raw transfer]




GOL_A_6(4WXK)
DEF_HAEI8
[Raw transfer]




GOL_D_12(4WXK)
DEF_HAEI8
[Raw transfer]




GOL_B_8(4WXK)
DEF_HAEI8
[Raw transfer]




EDO_A_10(5HGW)
?
[Raw transfer]




GLY_B_5(1Y6H)
DEF_LEPIN
[Raw transfer]




DTT_B_6(1SV2)
DEF_LEPIN
[Raw transfer]




BB2_B_6(2OKL)
DEF2_BACCR
[Raw transfer]




DTT_A_5(1SV2)
DEF_LEPIN
[Raw transfer]




BB2_B_6(2OKL)
DEF2_BACCR
[Raw transfer]




CHAIN_G_4(3G6N)
?
[Raw transfer]

-

CHAIN_D_3(1ZY1)
DEF1A_ARATH
[Raw transfer]

-

CHAIN_E_4(1ZY1)
DEF1A_ARATH
[Raw transfer]

-

CHAIN_F_3(3G6N)
?
[Raw transfer]

-

1 PsiBlast_PDB 92.1766% -92 - C5 -1LQY 6.9 DEF2_GEOSE
3 PsiBlast_PDB 90.3860%-103 - C5 -1LQW - DEF_STAAU -
2 PsiBlast_PDB 89.6065% -76 - C5 -2OKL 6.5 DEF2_BACCR
23 PsiBlast_CBE 89.2160% -91 - C5 -1LQW - DEF_STAAU -
21 PsiBlast_CBE 88.7665% -82 - C5 -2OKL 6.8 DEF2_BACCR
22 PsiBlast_CBE 88.0260% -97 - C5 -2AI9 - DEF_STAAU -
103 HHSearch 87.4665% -77 - C5 -2OKL 2.9 DEF2_BACCR
5 PsiBlast_PDB 87.1157% -90 - C5 -1LMH - DEF_STAAU -
4 PsiBlast_PDB 86.1860% -97 - C5 -2AI9 - DEF_STAAU -
8 PsiBlast_PDB 80.7453%-102 - C5 -2OS1 6.2 DEF_ENTFA
9 PsiBlast_PDB 80.1552%-100 - C5 -2OS0 - DEF_ENTFA -
6 PsiBlast_PDB 80.1352%-100 - C5 -3G6N 2.8 ?
25 PsiBlast_CBE 80.0952%-101 - C5 -3CMD - ? -
10 PsiBlast_PDB 79.8049% -93 - C5 -2OS3 5.7 DEF_STRP1
7 PsiBlast_PDB 79.7452%-100 - C5 -3CMD - ? -
24 PsiBlast_CBE 78.9652%-100 - C5 -3G6N 2.6 ?
104 HHSearch 78.9153% -97 - C5 -2OS0 - DEF_ENTFA -
11 PsiBlast_PDB 76.4848% -90 - C5 -3SW8 5.2 ?
14 PsiBlast_PDB 76.4148% -93 - C5 -2AIE 4.3 DEF_STRR6
13 PsiBlast_PDB 76.2248% -91 - C5 -2AIA 5.0 DEF_STRR6
12 PsiBlast_PDB 75.3748% -88 - C5 -2AI7 4.3 DEF_STRR6
109 HHSearch 66.1435% -98 - C5 -5HGW 2.1 ?
15 PsiBlast_PDB 64.2132% -88 - C5 -1Y6H 3.4 DEF_LEPIN
29 PsiBlast_CBE 64.0932% -89 - C5 -1VEV 2.6 DEF_LEPIN
26 PsiBlast_CBE 64.0432% -84 - C5 -1Y6H 3.1 DEF_LEPIN
17 PsiBlast_PDB 63.9332% -86 - C5 -1VEV 3.0 DEF_LEPIN
110 HHSearch 63.5736% -82 - C5 -1Y6H 3.4 DEF_LEPIN
16 PsiBlast_PDB 63.4632% -89 - C5 -1SV2 2.1 DEF_LEPIN
18 PsiBlast_PDB 63.4432% -86 - C5 -1VEY 2.5 DEF_LEPIN
28 PsiBlast_CBE 62.8832% -88 - C5 -1VEY 3.2 DEF_LEPIN
30 PsiBlast_CBE 62.4932% -89 - C5 -1SV2 2.3 DEF_LEPIN
27 PsiBlast_CBE 62.3432% -81 - C5 -1VEZ 3.2 DEF_LEPIN
19 PsiBlast_PDB 62.0632% -84 - C5 -1VEZ 3.2 DEF_LEPIN
46 PsiBlast_CBE 60.9733% -88 * C5 *1S17 4.7 DEF_PSEAE
101 HHSearch 59.8532%-106 - C5 -3U04 6.6 ?
47 PsiBlast_CBE 59.6333% -83 - C5 -1S17 4.5 DEF_PSEAE
105 HHSearch 59.4333% -99 - C5 -4WXK 2.5 DEF_HAEI8
49 PsiBlast_CBE 59.0833% -84 - C5 -1N5N 2.6 DEF_PSEAE
52 PsiBlast_CBE 58.1733% -86 - C5 -1IX1 6.2 DEF_PSEAE
102 HHSearch 57.2536% -73 - C5 -3UWB 6.2 ?
51 PsiBlast_CBE 57.0433% -82 - C5 -1IX1 6.3 DEF_PSEAE
50 PsiBlast_CBE 56.4633% -86 - C5 -1LRY 5.9 DEF_PSEAE
55 PsiBlast_CBE 55.7731% -88 - C5 -1ZY1 3.6 DEF1A_ARATH
56 PsiBlast_CBE 54.6731% -82 - C5 -1ZY1 4.3 DEF1A_ARATH
118 HHSearch 54.5732% -82 - C5 -1RL4 4.1 ?
106 HHSearch 52.3932% -70 - C5 -1N5N 2.6 DEF_PSEAE
38 PsiBlast_CBE 49.9038%-124 - C5 -4WXL 5.4 DEF_HAEI8
39 PsiBlast_CBE 47.8838%-118 - C5 -4WXL 5.1 DEF_HAEI8
45 PsiBlast_CBE 46.8838%-118 - C5 -4WXK 2.5 DEF_HAEI8
43 PsiBlast_CBE 46.3538%-118 - C5 -4WXK 2.7 DEF_HAEI8
42 PsiBlast_CBE 46.3338%-122 - C5 -4WXK 3.2 DEF_HAEI8
41 PsiBlast_CBE 45.9238%-127 - C5 -4WXL 5.9 DEF_HAEI8
40 PsiBlast_CBE 45.2038%-121 - C5 -4WXL 5.0 DEF_HAEI8
44 PsiBlast_CBE 43.4138%-119 - C5 -4WXK 3.1 DEF_HAEI8