@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu14610: (2016-06-22 )
MVVGDFPIETDTLVIGAGPGGYVAAIRAAQLGQKVTVVEKATLGGVCLNVGCIPSKALINAGHRYENAKHSDDMGITAENVTVDFTKVQEWKASVVNKLTGGVAGLLKGNKVDVVKGEAYFVDSNSVRVMDENSAQTYTFKNAIIATGSRPIELPNFKYSERVLNSTGALALKEIPKKLVVIGGGYIGTELGTAYANFGTELVILEGGDEILPGFEKQMSSLVTRRLKKKGNVEIHTNAMAKGVEERPDGVTVTFEVKGEEKTVDADYVLITVGRRPNTDELGLEQVGIEMTDRGIVKTDKQCRTNVPNIYAIGDIIEGPPLAHKASYEGKIAAEAIAGEPAEIDYLGIPAVVFSEPELASVGYTEAQAKEEGLDIVAAKFPFAANGRALSLNETDGFMKLITRKEDGLVIGAQIAGASASDMISELSLAIEGGMTAEDIAMTIHAHPTLGEITMEAAEVAIGSPIHIVK

Atome Classification :

(54 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_B_6(2EQ7)
?
[Raw transfer]




FAD_B_8(2YQU)
?
[Raw transfer]




FAD_B_4(2EQ6)
?
[Raw transfer]




FAD_B_5(1EBD)
DLDH1_GEOSE
[Raw transfer]




FAD_A_7(2YQU)
?
[Raw transfer]




FAD_A_7(2YQU)
?
[Raw transfer]




FAD_A_4(2EQ7)
?
[Raw transfer]




FAD_A_3(1LPF)
DLDH_PSEFL
[Raw transfer]




FAD_A_3(2A8X)
DLDH_MYCTU
[Raw transfer]




FAD_A_3(3URH)
?
[Raw transfer]




FAD_A_3(2EQ6)
?
[Raw transfer]




FAD_A_3(3URH)
?
[Raw transfer]




FAD_A_4(1EBD)
DLDH1_GEOSE
[Raw transfer]




FAD_A_3(3LAD)
DLDH_AZOVI
[Raw transfer]




FAD_A_4(1EBD)
DLDH1_GEOSE
[Raw transfer]




FAD_B_4(3LAD)
DLDH_AZOVI
[Raw transfer]




FAD_C_3(1OJT)
?
[Raw transfer]




FAD_A_3(3LAD)
DLDH_AZOVI
[Raw transfer]




FAD_A_3(2EQ6)
?
[Raw transfer]




FAD_B_4(1LPF)
DLDH_PSEFL
[Raw transfer]




FAD_A_4(1V59)
DLDH_YEAST
[Raw transfer]




FAD_A_5(4K8D)
MERA_PSEAI
[Raw transfer]




FAD_D_4(1JEH)
DLDH_YEAST
[Raw transfer]




FAD_B_5(1V59)
DLDH_YEAST
[Raw transfer]




FAD_C_3(1ZX9)
MERA_PSEAI
[Raw transfer]




FAD_A_4(1V59)
DLDH_YEAST
[Raw transfer]




FAD_A_2(4K7Z)
MERA_PSEAI
[Raw transfer]




FAD_C_3(1LVL)
DLDH1_PSEPU
[Raw transfer]




FAD_C_3(1JEH)
DLDH_YEAST
[Raw transfer]




FAD_A_3(3II4)
DLDH_MYCTU
[Raw transfer]




FAD_B_11(4JDR)
DLDH_ECOLI
[Raw transfer]




FAD_A_3(1GES)
GSHR_ECOLI
[Raw transfer]




FAD_C_3(1LVL)
DLDH1_PSEPU
[Raw transfer]




FAD_B_5(3II4)
DLDH_MYCTU
[Raw transfer]




FAD_A_3(2QAE)
DLDH_TRYCR
[Raw transfer]




FAD_A_3(4JDR)
DLDH_ECOLI
[Raw transfer]




FAD_B_10(2R9Z)
GASHR_MARGR
[Raw transfer]




FAD_I_9(1ZK7)
MERA_PSEAI
[Raw transfer]




FAD_A_3(2R9Z)
GASHR_MARGR
[Raw transfer]




FAD_A_2(4YWO)
?
[Raw transfer]




FAD_C_3(1BHY)
?
[Raw transfer]




FAD_C_3(1OJT)
?
[Raw transfer]




FAD_B_4(2QAE)
DLDH_TRYCR
[Raw transfer]




FAD_A_3(2QAE)
DLDH_TRYCR
[Raw transfer]




FAD_A_3(1GES)
GSHR_ECOLI
[Raw transfer]




FAD_B_5(1GEU)
GSHR_ECOLI
[Raw transfer]




FAD_B_4(1GES)
GSHR_ECOLI
[Raw transfer]




FAD_A_3(1GEU)
GSHR_ECOLI
[Raw transfer]




21 PsiBlast_CBE 96.0778%-115 - C2 -1EBD 12.6 DLDH1_GEOSE
1 PsiBlast_PDB 95.6978%-117 - C2 -1EBD - DLDH1_GEOSE -
135 HHSearch 95.4178%-117 - C2 -1EBD 12.9 DLDH1_GEOSE
112 Fugue 89.1973%-119 - C2 -1EBD 12.8 DLDH1_GEOSE
15 PsiBlast_PDB 80.2041%-126 - C2 -1LVL 11.8 DLDH1_PSEPU
22 PsiBlast_CBE 79.8347%-107 - C2 -4JQ9 - ? -
122 HHSearch 79.7942%-125 - C2 -1LVL 11.8 DLDH1_PSEPU
3 PsiBlast_PDB 79.7347%-110 - C2 -4JQ9 - ? -
17 PsiBlast_PDB 79.6743%-112 - C2 -2YQU 12.9 ?
13 PsiBlast_PDB 78.8241%-112 - C2 -3LAD 12.2 DLDH_AZOVI
7 PsiBlast_PDB 78.5842%-105 - C2 -1LPF 12.1 DLDH_PSEFL
77 PsiBlast_CBE 78.5743%-110 - C2 -2YQU 12.8 ?
2 PsiBlast_PDB 78.5547%-110 - C2 -4JDR 12.6 DLDH_ECOLI
125 HHSearch 78.5246%-110 - C2 -4JQ9 - ? -
26 PsiBlast_CBE 78.3447%-110 - C2 -4JQ9 - ? -
129 HHSearch 78.1842%-112 - C2 -3LAD 12.2 DLDH_AZOVI
25 PsiBlast_CBE 78.1847%-108 - C2 -4JQ9 - ? -
39 PsiBlast_CBE 78.1442%-106 - C2 -1LPF 12.5 DLDH_PSEFL
141 HHSearch 78.0043%-112 - C2 -2YQU 12.9 ?
19 PsiBlast_PDB 77.8543%-107 - C2 -3URH 12.5 ?
124 HHSearch 77.7443%-107 * C2 *3URH 12.5 ?
27 PsiBlast_CBE 77.5247%-108 - C2 -4JDR 12.6 DLDH_ECOLI
38 PsiBlast_CBE 77.4745%-100 - C2 -2EQ6 13.2 ?
73 PsiBlast_CBE 77.4641%-108 - C2 -3LAD 12.8 DLDH_AZOVI
78 PsiBlast_CBE 77.1843%-108 - C2 -2EQ7 13.0 ?
16 PsiBlast_PDB 77.1743%-108 - C2 -2EQ7 13.1 ?
123 HHSearch 76.4245%-103 - C2 -1OJT 10.3 ?
128 HHSearch 75.9745%-100 - C2 -2EQ6 13.3 ?
4 PsiBlast_PDB 75.4145% -99 - C2 -2EQ6 13.3 ?
89 PsiBlast_CBE 74.3038%-108 - C2 -3II4 12.5 DLDH_MYCTU
131 HHSearch 73.9343%-101 - C2 -2QAE 12.4 DLDH_TRYCR
90 PsiBlast_CBE 73.5138%-107 - C2 -3II4 11.1 DLDH_MYCTU
138 HHSearch 73.3737%-104 - C2 -2A8X 11.2 DLDH_MYCTU
134 HHSearch 72.5540% -92 - C2 -1V59 12.5 DLDH_YEAST
20 PsiBlast_PDB 70.9544%-103 - C2 -1OJT 9.1 ?
79 PsiBlast_CBE 70.7843%-102 - C2 -2QAE 11.1 DLDH_TRYCR
18 PsiBlast_PDB 70.1943%-102 - C2 -2QAE 11.3 DLDH_TRYCR
80 PsiBlast_CBE 69.8944%-102 - C2 -1BHY 9.2 ?
81 PsiBlast_CBE 69.8039% -87 - C2 -1V59 12.6 DLDH_YEAST
82 PsiBlast_CBE 69.6339% -88 - C2 -1V59 12.5 DLDH_YEAST
83 PsiBlast_CBE 69.5939% -90 - C2 -1JEH 13.0 DLDH_YEAST
84 PsiBlast_CBE 68.9239% -87 - C2 -1JEH 11.6 DLDH_YEAST
98 PsiBlast_CBE 65.6033%-102 - C2 -1ZX9 12.3 MERA_PSEAI
101 PsiBlast_CBE 65.5533%-102 - C2 -4K7Z 12.4 MERA_PSEAI
100 PsiBlast_CBE 65.3133%-104 - C2 -4K8D 12.0 MERA_PSEAI
99 PsiBlast_CBE 65.2933%-102 - C2 -1ZK7 12.8 MERA_PSEAI
136 HHSearch 64.9530%-100 - C2 -1GES 11.3 GSHR_ECOLI
91 PsiBlast_CBE 62.9131% -98 - C2 -2R9Z 10.5 GASHR_MARGR
92 PsiBlast_CBE 62.4331%-100 - C2 -2R9Z 11.8 GASHR_MARGR
93 PsiBlast_CBE 58.6932% -94 - C2 -4YWO 9.7 ?
97 PsiBlast_CBE 56.8631% -92 - C2 -1GES 8.5 GSHR_ECOLI
96 PsiBlast_CBE 56.8331% -90 - C2 -1GES 8.7 GSHR_ECOLI
95 PsiBlast_CBE 55.6231% -89 - C2 -1GEU 8.1 GSHR_ECOLI
94 PsiBlast_CBE 55.5531% -89 - C2 -1GEU 8.1 GSHR_ECOLI