@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu15020: (2016-06-23 )
MASIAVCPGSFDPVTYGHLDIIKRGAHIFEQVYVCVLNNSSKKPLFSVEERCELLREVTKDIPNITVETSQGLLIDYAKRKNAKAILRGLRAVSDFEYEMQGTSVNRVLDESIETFFMMTNNQYSFLSSSIVKEVARYNGSVSEFVPPEVELALQQKFRQG

Atome Classification :

(61 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

APC_B_6(3NBA)
COAD_MYCTU
[Raw transfer]




ATP_A_2(3UC5)
COAD_MYCTU
[Raw transfer]




APC_D_9(3NBA)
COAD_MYCTU
[Raw transfer]




APC_C_8(3NBA)
COAD_MYCTU
[Raw transfer]




ANP_B_12(3X1K)
?
[Raw transfer]




ATP_A_7(3ND6)
COAD_ENTFA
[Raw transfer]




COA_B_11(3OTW)
COAD_HELPY
[Raw transfer]




COA_E_18(3OTW)
COAD_HELPY
[Raw transfer]




COA_A_8(3OTW)
COAD_HELPY
[Raw transfer]




COD_A_2(3RBA)
COAD_MYCTU
[Raw transfer]




ATP_F_12(3ND6)
COAD_ENTFA
[Raw transfer]




ADP_A_5(1O6B)
COAD_BACSU
[Raw transfer]




COA_C_13(3OTW)
COAD_HELPY
[Raw transfer]




ADP_A_6(4NAT)
COAD_STAAW
[Raw transfer]




COA_D_15(3OTW)
COAD_HELPY
[Raw transfer]




4PS_A_2(3K9W)
COAD_BURP1
[Raw transfer]




COA_F_19(3OTW)
COAD_HELPY
[Raw transfer]




ACO_C_17(3X1J)
?
[Raw transfer]




COA_A_7(4RUK)
?
[Raw transfer]




ACO_B_13(3X1J)
?
[Raw transfer]




GOL_A_2(4E1A)
COAD_MYCTU
[Raw transfer]




COA_C_7(3PNB)
COAD_MYCTU
[Raw transfer]




COA_D_8(3PNB)
COAD_MYCTU
[Raw transfer]




COA_B_6(3PNB)
COAD_MYCTU
[Raw transfer]




COA_A_5(3PNB)
COAD_MYCTU
[Raw transfer]




GOL_C_25(3X1K)
?
[Raw transfer]




COA_A_2(3LCJ)
COAD_MYCTU
[Raw transfer]




PNS_A_2(1OD6)
COAD_THET8
[Raw transfer]




PNS_A_5(3NBK)
COAD_MYCTU
[Raw transfer]




PNS_A_5(3NBK)
COAD_MYCTU
[Raw transfer]




PNS_B_7(3NBK)
COAD_MYCTU
[Raw transfer]




PNS_D_10(3NBK)
COAD_MYCTU
[Raw transfer]




COA_A_2(3RHS)
COAD_MYCTU
[Raw transfer]




PNS_C_8(3NBK)
COAD_MYCTU
[Raw transfer]




ACY_A_6(3NV7)
COAD_HELPY
[Raw transfer]




ACY_A_6(3NV7)
COAD_HELPY
[Raw transfer]




2VJ_F_17(4NAH)
COAD_STAAW
[Raw transfer]




2VJ_B_11(4NAH)
COAD_STAAW
[Raw transfer]




2W3_A_5(4NAU)
COAD_STAAW
[Raw transfer]




2VJ_D_14(4NAH)
COAD_STAAW
[Raw transfer]




2VJ_F_18(4NAH)
COAD_STAAW
[Raw transfer]




2VJ_A_8(4NAH)
COAD_STAAW
[Raw transfer]




PNY_D_10(3ND7)
COAD_ENTFA
[Raw transfer]




PNS_A_7(1VLH)
COAD_THEMA
[Raw transfer]




PNS_F_12(1VLH)
COAD_THEMA
[Raw transfer]




2W5_C_10(4NAT)
COAD_STAAW
[Raw transfer]




2W5_A_4(4NAT)
COAD_STAAW
[Raw transfer]




PNS_B_8(1VLH)
COAD_THEMA
[Raw transfer]




2W5_B_7(4NAT)
COAD_STAAW
[Raw transfer]




2VJ_A_9(4NAH)
COAD_STAAW
[Raw transfer]




PNS_C_9(1VLH)
COAD_THEMA
[Raw transfer]




PNS_C_9(1VLH)
COAD_THEMA
[Raw transfer]




PNS_D_10(1VLH)
COAD_THEMA
[Raw transfer]




COA_B_16(3X1M)
?
[Raw transfer]




PNS_E_11(1VLH)
COAD_THEMA
[Raw transfer]




1 PsiBlast_PDB 83.9096%-136 - C2 -1O6B - COAD_BACSU -
113 HHSearch 82.2798%-136 - C2 -1O6B 6.7 COAD_BACSU
108 HHSearch 74.1348%-155 - C2 -1VLH 2.4 COAD_THEMA
31 PsiBlast_CBE 74.0449%-163 - C2 -1VLH 2.5 COAD_THEMA
6 PsiBlast_PDB 72.6449%-159 - C2 -1VLH 2.4 COAD_THEMA
34 PsiBlast_CBE 72.5449%-159 - C2 -1VLH 2.4 COAD_THEMA
30 PsiBlast_CBE 72.1549%-163 - C2 -1VLH 1.7 COAD_THEMA
2 PsiBlast_PDB 70.7557%-143 - C2 -3F3M - COAD_STAAW -
107 HHSearch 70.4646%-147 - C2 -3K9W 3.5 COAD_BURP1
112 HHSearch 69.7757%-145 - C2 -4NAT 4.3 COAD_STAAW
29 PsiBlast_CBE 69.4757%-136 - C2 -4NAH 2.5 COAD_STAAW
32 PsiBlast_CBE 69.1949%-159 - C2 -1VLH 2.9 COAD_THEMA
22 PsiBlast_CBE 68.8257%-140 - C2 -4NAU 2.2 COAD_STAAW
5 PsiBlast_PDB 68.6757%-141 - C2 -4NAU - COAD_STAAW -
123 Fugue 68.4242%-146 * C2 *1B6T - COAD_ECOLI -
21 PsiBlast_CBE 68.3557%-138 - C2 -4NAU - COAD_STAAW -
11 PsiBlast_PDB 68.3443%-135 - C2 -1GN8 - COAD_ECOLI -
3 PsiBlast_PDB 68.2157%-139 - C2 -4NAH 4.7 COAD_STAAW
24 PsiBlast_CBE 68.0757%-141 - C2 -4NAT 2.7 COAD_STAAW
89 PsiBlast_CBE 68.0242%-145 - C2 -3OTW 7.0 COAD_HELPY
33 PsiBlast_CBE 67.8649%-161 - C2 -1VLH 1.9 COAD_THEMA
23 PsiBlast_CBE 67.7357%-143 - C2 -4NAT 3.2 COAD_STAAW
28 PsiBlast_CBE 67.7257%-135 - C2 -4NAH 3.9 COAD_STAAW
25 PsiBlast_CBE 67.6657%-137 - C2 -4NAH 2.6 COAD_STAAW
4 PsiBlast_PDB 67.5257%-149 - C2 -4NAT 2.3 COAD_STAAW
27 PsiBlast_CBE 67.3857%-139 - C2 -4NAH 4.2 COAD_STAAW
91 PsiBlast_CBE 67.0342%-144 - C2 -3OTW 5.4 COAD_HELPY
104 HHSearch 66.9551%-144 - C2 -1OD6 3.4 COAD_THET8
26 PsiBlast_CBE 66.5557%-127 - C2 -4NAH 3.8 COAD_STAAW
105 HHSearch 64.8944%-137 - C2 -4RUK 5.4 ?
60 PsiBlast_CBE 64.7743%-148 - C2 -3NBK 3.5 COAD_MYCTU
111 HHSearch 64.6942%-144 - C2 -3NBK 3.5 COAD_MYCTU
90 PsiBlast_CBE 64.2542%-136 - C2 -3OTW 6.7 COAD_HELPY
88 PsiBlast_CBE 64.1342%-136 - C2 -3OTW 7.1 COAD_HELPY
92 PsiBlast_CBE 63.6842%-143 - C2 -3OTW 7.8 COAD_HELPY
59 PsiBlast_CBE 63.1943%-151 - C2 -3NBK 3.4 COAD_MYCTU
57 PsiBlast_CBE 62.7843%-154 - C2 -3NBK 3.2 COAD_MYCTU
58 PsiBlast_CBE 62.6843%-153 - C2 -3NBK 3.6 COAD_MYCTU
54 PsiBlast_CBE 62.5543%-148 - C2 -3PNB 5.6 COAD_MYCTU
73 PsiBlast_CBE 61.5843%-149 - C2 -3RHS 3.6 COAD_MYCTU
87 PsiBlast_CBE 61.3842%-138 - C2 -3OTW 4.9 COAD_HELPY
72 PsiBlast_CBE 61.1943%-152 - C2 -3UC5 6.7 COAD_MYCTU
65 PsiBlast_CBE 60.9343%-152 - C2 -3LCJ 4.1 COAD_MYCTU
63 PsiBlast_CBE 60.8943%-153 - C2 -3NBA 7.6 COAD_MYCTU
56 PsiBlast_CBE 60.7143%-150 - C2 -3PNB 5.5 COAD_MYCTU
49 PsiBlast_CBE 60.1445%-127 - C2 -3X1K 2.3 ?
93 PsiBlast_CBE 60.0842%-185 - C2 -3NV7 3.4 COAD_HELPY
53 PsiBlast_CBE 59.9443%-151 - C2 -3PNB 5.2 COAD_MYCTU
55 PsiBlast_CBE 59.7443%-156 - C2 -3PNB 5.3 COAD_MYCTU
61 PsiBlast_CBE 59.5743%-151 - C2 -3NBA 6.4 COAD_MYCTU
74 PsiBlast_CBE 59.5543%-153 - C2 -3RBA 7.2 COAD_MYCTU
64 PsiBlast_CBE 59.1743%-144 - C2 -4E1A 2.8 COAD_MYCTU
51 PsiBlast_CBE 58.7845%-122 - C2 -3X1J 6.5 ?
62 PsiBlast_CBE 58.5743%-152 - C2 -3NBA 6.9 COAD_MYCTU
18 PsiBlast_PDB 58.4345%-124 - C2 -3X1M 3.9 ?
50 PsiBlast_CBE 58.2845%-124 - C2 -3X1K 5.9 ?
52 PsiBlast_CBE 57.9945%-120 - C2 -3X1J 6.6 ?
110 HHSearch 57.8640%-181 - C2 -3NV7 3.4 COAD_HELPY
81 PsiBlast_CBE 56.9843%-136 - C2 -3ND6 5.2 COAD_ENTFA
86 PsiBlast_CBE 56.2743%-138 - C2 -3ND6 5.8 COAD_ENTFA
79 PsiBlast_CBE 53.7043%-132 - C2 -3ND7 2.3 COAD_ENTFA