@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu15290: (2016-06-23 )
MLEFETNIDGLASIKVIGVGGGGNNAVNRMIENEVQGVEYIAVNTDAQALNLSKAEVKMQIGAKLTRGLGAGANPEVGKKAAEESKEQIEEALKGADMVFVTAGMGGGTGTGAAPVIAQIAKDLGALTVGVVTRPFTFEGRKRQLQAAGGISAMKEAVDTLIVIPNDRILEIVDKNTPMLEAFREADNVLRQGVQGISDLIATPGLINLDFADVKTIMSNKGSALMGIGIATGENRAAEAAKKAISSPLLEAAIDGAQGVLMNITGGTNLSLYEVQEAADIVASASDQDVNMIFGSVINENLKDEIVVTVIATGFIEQEKDVTKPQRPSLNQSIKTHNQSVPKREPKREEPQQQNTVSRHTSQPADDTLDIPTFLRNRNKRG

Atome Classification :

(53 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GTP_A_3(3WGM)
FTSZ_STAAM
[Raw transfer]




GTP_B_5(3WGM)
FTSZ_STAAM
[Raw transfer]




G2P_A_3(1W5F)
FTSZ_THEMA
[Raw transfer]




G2P_A_3(1W5F)
FTSZ_THEMA
[Raw transfer]




GSP_A_3(3WGN)
FTSZ_STAAM
[Raw transfer]




GSP_B_4(3WGN)
FTSZ_STAAM
[Raw transfer]




G2P_B_5(1W5F)
FTSZ_THEMA
[Raw transfer]




GTP_A_3(1W5A)
FTSZ1_METJA
[Raw transfer]




GTP_B_4(1W5B)
FTSZ1_METJA
[Raw transfer]




GDP_A_3(2RHL)
FTSZ_BACSU
[Raw transfer]




GTP_B_5(1W5A)
FTSZ1_METJA
[Raw transfer]




GTP_A_3(1W5B)
FTSZ1_METJA
[Raw transfer]




GDP_A_4(3VO8)
FTSZ_STAAM
[Raw transfer]




GDP_A_2(4DXD)
FTSZ_STAAU
[Raw transfer]




GDP_A_2(4M8I)
FTSZ_STAEQ
[Raw transfer]




GSP_A_3(2RHO)
FTSZ_BACSU
[Raw transfer]




GDP_A_2(4M8I)
FTSZ_STAEQ
[Raw transfer]




GDP_B_4(2RHO)
FTSZ_BACSU
[Raw transfer]




GDP_A_3(3WGK)
FTSZ_STAAM
[Raw transfer]




GDP_B_6(3VO8)
FTSZ_STAAM
[Raw transfer]




GDP_B_4(2RHL)
FTSZ_BACSU
[Raw transfer]




GSP_A_3(1RLU)
FTSZ_MYCTU
[Raw transfer]




GSP_A_3(2Q1Y)
FTSZ_MYCTU
[Raw transfer]




GDP_B_4(3WGK)
FTSZ_STAAM
[Raw transfer]




GDP_A_2(2VAW)
FTSZ_PSEAE
[Raw transfer]




GDP_A_5(1OFU)
FTSZ_PSEAE
[Raw transfer]




GDP_A_3(3WGL)
FTSZ_STAAM
[Raw transfer]




GDP_A_5(1OFU)
FTSZ_PSEAE
[Raw transfer]




GDP_A_2(2VAW)
FTSZ_PSEAE
[Raw transfer]




GDP_B_6(1OFU)
FTSZ_PSEAE
[Raw transfer]




GDP_A_3(3VOB)
FTSZ_STAAM
[Raw transfer]




GDP_A_2(2VAP)
FTSZ1_METJA
[Raw transfer]




GDP_D_4(1FSZ)
FTSZ1_METJA
[Raw transfer]




GDP_A_2(2VAP)
FTSZ1_METJA
[Raw transfer]




GDP_B_4(3WGL)
FTSZ_STAAM
[Raw transfer]




GDP_A_2(3VOA)
FTSZ_STAAM
[Raw transfer]




GDP_B_5(4KWE)
FTSZ_MYCTU
[Raw transfer]




GDP_C_3(1RQ7)
FTSZ_MYCTU
[Raw transfer]




GDP_A_4(4KWE)
FTSZ_MYCTU
[Raw transfer]




GDP_C_6(4KWE)
FTSZ_MYCTU
[Raw transfer]




CIT_A_2(2VXY)
FTSZ_BACSU
[Raw transfer]




CIT_A_2(2VXY)
FTSZ_BACSU
[Raw transfer]




CIT_A_3(1RQ2)
FTSZ_MYCTU
[Raw transfer]




CIT_A_3(1RQ2)
FTSZ_MYCTU
[Raw transfer]




CIT_A_3(2Q1X)
FTSZ_MYCTU
[Raw transfer]




1 PsiBlast_PDB 91.4899%-118 - C3 -2VAM - FTSZ_BACSU -
71 HHSearch 90.85100%-115 - C3 -2VXY 3.3 FTSZ_BACSU
2 PsiBlast_PDB 90.6399%-115 - C3 -2VXY 3.3 FTSZ_BACSU
3 PsiBlast_PDB 90.1199%-111 - C3 -2RHH - FTSZ_BACSU -
4 PsiBlast_PDB 89.5199%-113 - C3 -2RHJ - FTSZ_BACSU -
22 PsiBlast_CBE 89.4199%-107 - C3 -2RHL 7.6 FTSZ_BACSU
7 PsiBlast_PDB 89.3099%-113 - C3 -4U39 - FTSZ_BACSU -
5 PsiBlast_PDB 88.7999%-113 - C3 -2RHL 7.6 FTSZ_BACSU
6 PsiBlast_PDB 88.2099%-110 - C3 -2RHO 7.9 FTSZ_BACSU
21 PsiBlast_CBE 88.0999%-112 - C3 -2RHO 7.2 FTSZ_BACSU
24 PsiBlast_CBE 85.5099%-105 - C3 -4U39 - FTSZ_BACSU -
25 PsiBlast_CBE 85.0099%-106 - C3 -4U39 - FTSZ_BACSU -
26 PsiBlast_CBE 84.7599%-110 - C3 -4U39 - FTSZ_BACSU -
73 HHSearch 84.1378%-102 - C3 -4M8I 8.5 FTSZ_STAEQ
23 PsiBlast_CBE 84.0399%-113 - C3 -4U39 - FTSZ_BACSU -
15 PsiBlast_PDB 83.9379%-107 - C3 -4M8I 8.5 FTSZ_STAEQ
10 PsiBlast_PDB 83.3669%-104 - C3 -4DXD 7.6 FTSZ_STAAU
28 PsiBlast_CBE 83.2769%-108 - C3 -3VO8 7.0 FTSZ_STAAM
12 PsiBlast_PDB 82.0869%-106 - C3 -3WGM 9.1 FTSZ_STAAM
8 PsiBlast_PDB 81.7269%-105 - C3 -3VO8 7.2 FTSZ_STAAM
29 PsiBlast_CBE 81.5669%-104 - C3 -3WGM 8.7 FTSZ_STAAM
27 PsiBlast_CBE 80.9069%-109 - C3 -3WGN 6.8 FTSZ_STAAM
9 PsiBlast_PDB 80.6569%-108 - C3 -3WGN 6.6 FTSZ_STAAM
30 PsiBlast_CBE 80.0669%-107 - C3 -3WGL 6.1 FTSZ_STAAM
13 PsiBlast_PDB 80.0269%-112 - C3 -3WGK 6.1 FTSZ_STAAM
11 PsiBlast_PDB 79.8369%-108 - C3 -3WGL 6.0 FTSZ_STAAM
31 PsiBlast_CBE 79.7169%-107 - C3 -3WGK 5.8 FTSZ_STAAM
77 HHSearch 78.6556%-117 * C3 *1OFU 6.5 FTSZ_PSEAE
74 HHSearch 78.5363%-115 - C3 -1RQ2 3.1 FTSZ_MYCTU
40 PsiBlast_CBE 78.1656%-116 - C3 -1OFU 6.6 FTSZ_PSEAE
41 PsiBlast_CBE 78.0956%-117 - C3 -1OFU 6.5 FTSZ_PSEAE
76 HHSearch 77.5347%-120 - C3 -2VAP 6.9 FTSZ1_METJA
16 PsiBlast_PDB 77.4680%-101 - C3 -3VOA 5.7 FTSZ_STAAM
17 PsiBlast_PDB 77.3880% -99 - C3 -3VOB 5.1 FTSZ_STAAM
55 PsiBlast_CBE 77.1149%-122 - C3 -1W5B 7.5 FTSZ1_METJA
53 PsiBlast_CBE 76.9549%-124 - C3 -2VAP 6.9 FTSZ1_METJA
57 PsiBlast_CBE 76.3349%-117 - C3 -1W5A 7.1 FTSZ1_METJA
72 HHSearch 76.2355%-111 - C3 -2VAW 5.8 FTSZ_PSEAE
56 PsiBlast_CBE 75.8549%-120 - C3 -1W5A 6.6 FTSZ1_METJA
34 PsiBlast_CBE 75.1259%-119 - C3 -4KWE 5.3 FTSZ_MYCTU
33 PsiBlast_CBE 75.0259%-120 - C3 -4KWE 5.2 FTSZ_MYCTU
18 PsiBlast_PDB 74.9359%-105 - C3 -1RLU 6.4 FTSZ_MYCTU
39 PsiBlast_CBE 74.6148%-111 - C3 -2VAW 5.8 FTSZ_PSEAE
35 PsiBlast_CBE 74.5459%-115 - C3 -4KWE 5.6 FTSZ_MYCTU
54 PsiBlast_CBE 74.3949%-116 - C3 -1W5B 7.3 FTSZ1_METJA
20 PsiBlast_PDB 74.3359%-113 - C3 -1RQ7 5.7 FTSZ_MYCTU
37 PsiBlast_CBE 74.2559%-107 - C3 -2Q1Y 6.9 FTSZ_MYCTU
60 PsiBlast_CBE 73.9249%-117 - C3 -1FSZ 6.0 FTSZ1_METJA
38 PsiBlast_CBE 73.1859%-111 - C3 -2Q1X 4.0 FTSZ_MYCTU
19 PsiBlast_PDB 72.9559%-110 - C3 -1RQ2 2.7 FTSZ_MYCTU
42 PsiBlast_CBE 65.4550% -97 - C3 -1W5F 7.7 FTSZ_THEMA
43 PsiBlast_CBE 64.1650% -96 - C3 -1W5F 8.1 FTSZ_THEMA
78 HHSearch 64.0949% -95 - C3 -1W5F 8.1 FTSZ_THEMA