@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu15320: (2016-06-24 )
MKKLKLRLTHLWYKLLMKLGLKSDEVYYIGGSEALPPPLSKDEEQVLLMKLPNGDQAARAILIERNLRLVVYIARKFENTGINIEDLISIGTIGLIKAVNTFNPEKKIKLATYASRCIENEILMYLRRNNKIRSEVSFDEPLNIDWDGNELLLSDVLGTDDDIITKDIEANVDKKLLKKALEQLNEREKQIMELRFGLVGEEEKTQKDVADMMGISQSYISRLEKRIIKRLRKEFNKMV

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_B_2(3UGO)
SIGA_THEAQ
[Raw transfer]

-

50 HHSearch 81.1430%-129 - C5 -1L9Z - SIGA_THEAQ -
48 HHSearch 79.2931%-100 - C5 -5IPL - ? -
10 PsiBlast_PDB 78.7228%-142 - C5 -4XLS - SIGA_THEAQ -
9 PsiBlast_PDB 78.2128%-135 - C5 -4XLR - SIGA_THEAQ -
8 PsiBlast_PDB 77.9328%-138 - C5 -4XLQ - SIGA_THEAQ -
18 PsiBlast_PDB 77.3627%-132 - C5 -4OIP - ? -
20 PsiBlast_PDB 77.1427%-137 - C5 -4OIR - ? -
7 PsiBlast_PDB 76.9928%-131 - C5 -4XLP - SIGA_THEAQ -
6 PsiBlast_PDB 76.6428%-130 - C5 -4XLN - SIGA_THEAQ -
15 PsiBlast_PDB 76.6227%-113 - C5 -4MQ9 - ? -
16 PsiBlast_PDB 76.5627%-136 - C5 -4OIN - ? -
13 PsiBlast_PDB 76.3027%-123 - C5 -4G7O - ? -
17 PsiBlast_PDB 76.1727%-129 - C5 -4OIO - ? -
14 PsiBlast_PDB 75.8527%-127 - C5 -4G7Z - ? -
11 PsiBlast_PDB 75.8328%-128 - C5 -1L9Z - SIGA_THEAQ -
12 PsiBlast_PDB 75.8027%-121 - C5 -4G7H - ? -
19 PsiBlast_PDB 75.2227%-131 - C5 -4OIQ - ? -
5 PsiBlast_PDB 74.9228%-129 - C5 -1L9U - SIGA_THEAQ -
54 HHSearch 74.7025%-118 - C5 -4YFK - RPOD_ECOLI -
4 PsiBlast_PDB 74.5429%-100 - C5 -5IPN - ? -