@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu15470: (2016-06-24 )
MNQKAVILDEQAIRRALTRIAHEMIERNKGMNNCILVGIKTRGIYLAKRLAERIEQIEGNPVTVGEIDITLYRDDLSKKTSNDEPLVKGADIPVDITDQKVILVDDVLYTGRTVRAGMDALVDVGRPSSIQLAVLVDRGHRELPIRADYIGKNIPTSKSEKVMVQLDEVDQNDLVAIYENE

Atome Classification :

(25 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

5GP_D_11(4P86)
?
[Raw transfer]




5GP_C_10(4P86)
?
[Raw transfer]




U5P_D_8(4P83)
?
[Raw transfer]




5GP_B_7(4P86)
?
[Raw transfer]




U5P_C_7(4P83)
?
[Raw transfer]




U5P_A_5(4P83)
?
[Raw transfer]




5GP_A_5(4P86)
?
[Raw transfer]




U5P_B_6(4P83)
?
[Raw transfer]




U5P_A_3(2IGB)
PYRR_BACCL
[Raw transfer]




U5P_B_4(2IGB)
PYRR_BACCL
[Raw transfer]




5GP_A_5(1XZ8)
PYRR_BACCL
[Raw transfer]




U5P_B_7(1XZ8)
PYRR_BACCL
[Raw transfer]




GOL_C_8(4P81)
?
[Raw transfer]




3GP_A_6(1XZ8)
PYRR_BACCL
[Raw transfer]




URF_C_8(5IAO)
?
[Raw transfer]




URF_A_7(5IAO)
?
[Raw transfer]




URF_F_9(5IAO)
?
[Raw transfer]




24 PsiBlast_CBE 82.15100%-147 - C2 -4P86 6.3 ?
23 PsiBlast_CBE 81.50100%-139 - C2 -4P86 6.7 ?
22 PsiBlast_CBE 80.63100%-142 - C2 -4P86 6.5 ?
4 PsiBlast_PDB 80.62100%-142 - C2 -4P86 7.1 ?
1 PsiBlast_PDB 79.74100%-136 - C2 -1A4X - PYRR_BACSU -
21 PsiBlast_CBE 79.04100%-134 - C2 -1A4X - PYRR_BACSU -
3 PsiBlast_PDB 77.97100%-121 - C2 -4P82 - PYRR_BACSU -
5 PsiBlast_PDB 77.0193%-148 - C2 -4P80 - ? -
30 PsiBlast_CBE 76.8378%-149 - C2 -4P83 5.2 ?
9 PsiBlast_PDB 75.7078%-156 - C2 -4P83 5.4 ?
31 PsiBlast_CBE 75.4378%-151 - C2 -4P83 5.7 ?
25 PsiBlast_CBE 75.4093%-144 - C2 -4P80 - ? -
2 PsiBlast_PDB 75.27100%-136 - C2 -1A3C - PYRR_BACSU -
12 PsiBlast_PDB 75.0773%-159 - C2 -1XZN - PYRR_BACCL -
13 PsiBlast_PDB 74.4873%-145 - C2 -2IGB 6.7 PYRR_BACCL
27 PsiBlast_CBE 74.2582%-147 - C2 -4P81 2.9 ?
32 PsiBlast_CBE 73.8473%-143 - C2 -2IGB 6.3 PYRR_BACCL
58 HHSearch 73.4194%-127 - C2 -4P82 - PYRR_BACSU -
29 PsiBlast_CBE 73.3578%-144 - C2 -4P83 7.5 ?
26 PsiBlast_CBE 72.8982%-141 - C2 -4P81 - ? -
11 PsiBlast_PDB 71.1373%-155 - C2 -1XZ8 5.0 PYRR_BACCL
34 PsiBlast_CBE 68.7573%-153 - C2 -1XZ8 4.9 PYRR_BACCL
16 PsiBlast_PDB 67.7753%-162 - C2 -5IAO 3.6 ?
39 PsiBlast_CBE 67.6353%-159 - C2 -5IAO 3.8 ?
38 PsiBlast_CBE 66.5953%-158 - C2 -5IAO 4.1 ?