@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu15540: (2016-06-24 )
MLEVKLPGLDLKNPIIPASGCFGFGKEFSRFYDLSCLGAIMIKATTKEPRFGNPTPRVAETGAGMLNAIGLQNPGLDSVLHHELPWLEQFDTPIIANVAGSQVDDYVEVAEHISKAPNVHALELNISCPNVKTGGIAFGTNPEMAADLTKAVKEVSDVPVYVKLSPNVANITEIALAIEEAGADGLTMINTLIGMRLDLKTGKPILANKTGGLSGPAVKPVAIRMVYEVSQMVNIPIIGMGGVQTAEDALEFLLAGASAVAVGTANFVNPFACPEIIEQLPSVLLQYGYQSIEECIGRSWNHEKQPAHHRA

Atome Classification :

(23 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OXC_A_5(2E6F)
PYRD_TRYCC
[Raw transfer]




DOR_A_4(3KVL)
PYRD_HUMAN
[Raw transfer]




DOR_A_4(3KVJ)
PYRD_HUMAN
[Raw transfer]




ORO_A_3(4JGD)
PYRD_HUMAN
[Raw transfer]




ORO_A_4(2DOR)
PYRDA_LACLM
[Raw transfer]




FMN_A_3(1EP3)
PYRDB_LACLM
[Raw transfer]




ORO_A_7(1OVD)
PYRDA_LACLM
[Raw transfer]




FMN_A_3(1EP1)
PYRDB_LACLM
[Raw transfer]




FMN_A_3(1EP2)
PYRDB_LACLM
[Raw transfer]




ORO_A_3(4OQV)
PYRD_HUMAN
[Raw transfer]




ACY_A_7(1JUE)
PYRDA_LACLM
[Raw transfer]




FAD_B_4(1EP3)
PYRDB_LACLM
[Raw transfer]




1 PsiBlast_PDB 93.5168%-131 - C1 -1EP1 8.7 PYRDB_LACLM
2 PsiBlast_PDB 93.3568%-129 - C1 -1EP2 8.6 PYRDB_LACLM
59 Fugue 91.5267%-128 - C1 -1EP3 - PYRDB_LACLM -
3 PsiBlast_PDB 90.4468%-125 - C1 -1EP3 8.1 PYRDB_LACLM
37 HHSearch 90.2367%-122 * C1 *1EP3 2.1 PYRDB_LACLM
41 HHSearch 67.8330%-112 - C1 -4EF8 - ? -
40 HHSearch 64.3729%-109 - C1 -2E6F 4.7 PYRD_TRYCC
58 Fugue 61.6829%-104 - C1 -2DOR - PYRDA_LACLM -
12 PsiBlast_PDB 60.8630%-103 - C1 -2BSL - PYRDA_LACLM -
11 PsiBlast_PDB 60.7430%-102 - C1 -1JUE 3.0 PYRDA_LACLM
13 PsiBlast_PDB 60.5430%-104 - C1 -2BX7 - PYRDA_LACLM -
10 PsiBlast_PDB 60.3830%-101 - C1 -2DOR 3.7 PYRDA_LACLM
14 PsiBlast_PDB 59.7030%-104 - C1 -1JUB - PYRDA_LACLM -
9 PsiBlast_PDB 59.5530%-102 - C1 -1DOR - PYRDA_LACLM -
15 PsiBlast_PDB 59.5230%-103 - C1 -1OVD 3.7 PYRDA_LACLM
42 HHSearch 58.9430%-106 - C1 -1JUB - PYRDA_LACLM -
17 PsiBlast_PDB 58.8330% -92 - C1 -3KVK - PYRD_HUMAN -
19 PsiBlast_PDB 58.0630% -90 - C1 -3KVM - PYRD_HUMAN -
47 HHSearch 57.6328%-112 - C1 -1GTE - DPYD_PIG -
16 PsiBlast_PDB 57.5930% -89 - C1 -3KVJ 4.1 PYRD_HUMAN
8 PsiBlast_PDB 57.5030%-101 - C1 -4OQV 3.6 PYRD_HUMAN
18 PsiBlast_PDB 57.3430% -88 - C1 -3KVL 4.2 PYRD_HUMAN
20 PsiBlast_PDB 56.5330% -90 - C1 -4JGD 3.8 PYRD_HUMAN