@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu15720: (2016-06-24 )
MAVKKVVTHPAEVLETPAETVTVFDKKLKKLLDDMYDTMLEMDGVGLAAPQIGILKRAAVVEIGDDRGRIDLVNPEILEKSGEQTGIEGCLSFPNVYGDVTRADYVKVRAFNRQGKPFILEARGFLARAVQHEMDHLDGVLFTSKISKYYTEDELADMEG

Atome Classification :

(95 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2BB_A_5(3K6L)
DEF_ECOLI
[Raw transfer]




BB1_C_9(1G27)
DEF_ECOLI
[Raw transfer]




BB2_C_9(1G2A)
DEF_ECOLI
[Raw transfer]




BB1_B_8(1G27)
DEF_ECOLI
[Raw transfer]




BB1_A_7(1G27)
DEF_ECOLI
[Raw transfer]




BB2_A_3(1WS1)
DEF1_BACCR
[Raw transfer]




2BB_B_7(3K6L)
DEF_ECOLI
[Raw transfer]




BB2_D_17(4DR9)
?
[Raw transfer]




BB2_C_11(1LRU)
DEF_ECOLI
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_B_10(1LRU)
DEF_ECOLI
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_A_3(4E9B)
?
[Raw transfer]




BB2_B_8(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_A_7(1G2A)
DEF_ECOLI
[Raw transfer]




BB2_C_14(4DR9)
?
[Raw transfer]




BB2_A_9(1LRU)
DEF_ECOLI
[Raw transfer]




BB2_A_5(3U04)
?
[Raw transfer]




BB2_A_5(1IX1)
DEF_PSEAE
[Raw transfer]




BB2_B_7(1IX1)
DEF_PSEAE
[Raw transfer]




BB2_D_12(4WXL)
DEF_HAEI8
[Raw transfer]




BB2_B_10(4DR9)
?
[Raw transfer]




BB2_A_2(3PN4)
DEF1B_ARATH
[Raw transfer]




BB2_A_7(4DR9)
?
[Raw transfer]




BB2_A_3(1LRY)
DEF_PSEAE
[Raw transfer]




BB2_A_2(3M6Q)
DEF1B_ARATH
[Raw transfer]




BB2_A_5(3UWB)
?
[Raw transfer]




BB2_A_5(3U04)
?
[Raw transfer]




MLN_A_4(1BSJ)
DEF_ECOLI
[Raw transfer]




BB2_B_9(3M6P)
DEF1B_ARATH
[Raw transfer]




BB2_A_3(3M6P)
DEF1B_ARATH
[Raw transfer]




BB2_C_10(4WXL)
DEF_HAEI8
[Raw transfer]




MLN_A_4(1BSK)
DEF_ECOLI
[Raw transfer]




BB2_B_8(4WXL)
DEF_HAEI8
[Raw transfer]




FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




BB2_A_6(4WXL)
DEF_HAEI8
[Raw transfer]




FMT_A_3(1XEN)
DEF_ECOLI
[Raw transfer]




GOL_D_12(4WXK)
DEF_HAEI8
[Raw transfer]




NVC_A_3(3E3U)
DEF_MYCTU
[Raw transfer]




GOL_A_7(1N5N)
DEF_PSEAE
[Raw transfer]




FMT_A_3(1XEO)
DEF_ECOLI
[Raw transfer]




GOL_A_7(1N5N)
DEF_PSEAE
[Raw transfer]




SB7_B_8(2AI8)
DEF_ECOLI
[Raw transfer]




FMT_A_3(1XEM)
DEF_ECOLI
[Raw transfer]




GOL_C_10(4WXK)
DEF_HAEI8
[Raw transfer]




SB7_A_7(2AI8)
DEF_ECOLI
[Raw transfer]




GOL_B_6(1N5N)
DEF_PSEAE
[Raw transfer]




FMT_A_13(1Y6H)
DEF_LEPIN
[Raw transfer]




FMT_B_11(4DR8)
?
[Raw transfer]




FMT_A_3(2W3U)
DEF_ECOLI
[Raw transfer]




GOL_A_6(4WXK)
DEF_HAEI8
[Raw transfer]




GOL_B_8(4WXK)
DEF_HAEI8
[Raw transfer]




SB7_C_9(2AI8)
DEF_ECOLI
[Raw transfer]




GOL_A_6(4WXK)
DEF_HAEI8
[Raw transfer]




2PE_A_9(1BSZ)
DEF_ECOLI
[Raw transfer]




FMT_C_14(4DR8)
?
[Raw transfer]




FMT_A_5(1XEN)
DEF_ECOLI
[Raw transfer]




GNR_B_6(1S17)
DEF_PSEAE
[Raw transfer]




BRR_B_7(1RL4)
?
[Raw transfer]




BRR_A_5(1RL4)
?
[Raw transfer]




BB2_A_3(2KMN)
DEF_ECOLI
[Raw transfer]




BRR_A_5(1RL4)
?
[Raw transfer]




GNR_A_5(1S17)
DEF_PSEAE
[Raw transfer]




BB4_A_8(3O3J)
DEF1B_ARATH
[Raw transfer]




Y13_A_3(2EW6)
?
[Raw transfer]




FMT_D_16(4DR8)
?
[Raw transfer]




2PE_A_9(1ICJ)
DEF_ECOLI
[Raw transfer]




2PE_C_11(1BS4)
DEF_ECOLI
[Raw transfer]




2PE_A_9(1BS4)
DEF_ECOLI
[Raw transfer]




Y12_A_3(2EW5)
?
[Raw transfer]




2PE_B_10(1BSZ)
DEF_ECOLI
[Raw transfer]




2PE_C_11(1ICJ)
DEF_ECOLI
[Raw transfer]




2PE_C_11(1BSZ)
DEF_ECOLI
[Raw transfer]




QAP_A_3(4E9A)
?
[Raw transfer]




QAP_A_3(4E9A)
?
[Raw transfer]




2PE_B_10(1ICJ)
DEF_ECOLI
[Raw transfer]




2PE_B_10(1BS4)
DEF_ECOLI
[Raw transfer]




EDO_A_10(5HGW)
?
[Raw transfer]




EOH_A_4(2W3T)
DEF_ECOLI
[Raw transfer]




EOH_A_4(2W3T)
DEF_ECOLI
[Raw transfer]




CHAIN_F_6(1BS6)
DEF_ECOLI
[Raw transfer]

-

H2S_B_7(4AL2)
DEF_ECOLI
[Raw transfer]




CHAIN_E_5(1BS6)
DEF_ECOLI
[Raw transfer]

-

CHAIN_D_4(1BS8)
DEF_ECOLI
[Raw transfer]

-

H2S_C_9(4AL2)
DEF_ECOLI
[Raw transfer]




CHAIN_E_5(1BS8)
DEF_ECOLI
[Raw transfer]

-

H2S_A_3(4AZ4)
?
[Raw transfer]




H2S_A_5(4AL2)
DEF_ECOLI
[Raw transfer]




CHAIN_F_6(1BS8)
DEF_ECOLI
[Raw transfer]

-

CHAIN_D_4(1BS6)
DEF_ECOLI
[Raw transfer]

-

EDO_B_10(4DR8)
?
[Raw transfer]




EDO_B_10(4DR8)
?
[Raw transfer]




110 HHSearch 93.6967% -89 - C5 -1WS0 - DEF1_BACCR -
1 PsiBlast_PDB 93.6967% -89 - C5 -1WS0 - DEF1_BACCR -
2 PsiBlast_PDB 92.2267% -90 - C5 -1WS1 7.1 DEF1_BACCR
61 PsiBlast_CBE 86.7145%-112 - C5 -4WXK 2.3 DEF_HAEI8
60 PsiBlast_CBE 86.6845%-107 - C5 -4WXK 2.3 DEF_HAEI8
57 PsiBlast_CBE 85.9945%-111 - C5 -4WXL 5.2 DEF_HAEI8
58 PsiBlast_CBE 85.9445%-108 - C5 -4WXK 3.5 DEF_HAEI8
54 PsiBlast_CBE 85.7945%-110 - C5 -4WXL 5.4 DEF_HAEI8
55 PsiBlast_CBE 85.4745%-108 - C5 -4WXL 4.8 DEF_HAEI8
59 PsiBlast_CBE 84.8445%-107 - C5 -4WXK 3.7 DEF_HAEI8
56 PsiBlast_CBE 84.5745%-111 - C5 -4WXL 4.9 DEF_HAEI8
23 PsiBlast_CBE 83.3547%-109 - C5 -4AL2 2.8 DEF_ECOLI
44 PsiBlast_CBE 83.1347% -95 - C5 -1BS7 - DEF_ECOLI -
24 PsiBlast_CBE 82.9847% -98 - C5 -4AL2 2.8 DEF_ECOLI
32 PsiBlast_CBE 82.9547% -94 - C5 -1LRU 6.7 DEF_ECOLI
48 PsiBlast_CBE 82.6747% -95 - C5 -1BS5 - DEF_ECOLI -
46 PsiBlast_CBE 82.5847% -95 - C5 -1BS6 3.8 DEF_ECOLI
63 PsiBlast_CBE 82.5739% -95 - C5 -4E9A 3.2 ?
12 PsiBlast_PDB 82.4947%-101 - C5 -1BS6 3.6 DEF_ECOLI
79 PsiBlast_CBE 82.4340% -84 - C5 -1N5N 2.8 DEF_PSEAE
112 HHSearch 82.1441% -97 - C5 -4WXK 2.4 DEF_HAEI8
9 PsiBlast_PDB 82.1147% -93 - C5 -1ICJ 5.6 DEF_ECOLI
15 PsiBlast_PDB 81.7947% -92 - C5 -1BSZ 5.5 DEF_ECOLI
26 PsiBlast_CBE 81.7647% -92 - C5 -2AI8 4.0 DEF_ECOLI
14 PsiBlast_PDB 81.6647%-101 - C5 -1BS8 3.6 DEF_ECOLI
10 PsiBlast_PDB 81.6647% -91 - C5 -1BS4 5.7 DEF_ECOLI
42 PsiBlast_CBE 81.3847% -96 - C5 -1BS8 3.8 DEF_ECOLI
20 PsiBlast_PDB 81.3347% -94 - C5 -1LRU 6.1 DEF_ECOLI
3 PsiBlast_PDB 81.1948% -99 - C5 -3K6L 5.3 DEF_ECOLI
27 PsiBlast_CBE 81.1847% -91 - C5 -2AI8 3.6 DEF_ECOLI
39 PsiBlast_CBE 81.1547% -95 - C5 -1BSZ 4.3 DEF_ECOLI
19 PsiBlast_PDB 81.1447% -99 - C5 -1G2A 6.0 DEF_ECOLI
45 PsiBlast_CBE 81.1247% -96 - C5 -1BS6 3.8 DEF_ECOLI
40 PsiBlast_CBE 81.0747% -96 - C5 -1BSZ 4.7 DEF_ECOLI
7 PsiBlast_PDB 81.0247% -95 - C5 -2W3U 3.4 DEF_ECOLI
77 PsiBlast_CBE 80.9840% -89 - C5 -1S17 3.0 DEF_PSEAE
114 HHSearch 80.8137%-111 - C5 -3U04 6.8 ?
37 PsiBlast_CBE 80.6247% -92 - C5 -1G27 5.3 DEF_ECOLI
41 PsiBlast_CBE 80.5747% -94 - C5 -1BS8 3.5 DEF_ECOLI
35 PsiBlast_CBE 80.4947% -97 - C5 -1G2A 6.8 DEF_ECOLI
65 PsiBlast_CBE 80.4739% -94 - C5 -2EW6 6.3 ?
102 Fugue 80.4442% -95 - C5 -1G2A 5.3 DEF_ECOLI
25 PsiBlast_CBE 80.4347% -93 - C5 -2AI8 3.8 DEF_ECOLI
122 HHSearch 80.3838% -88 - C5 -4E9A 3.2 ?
17 PsiBlast_PDB 80.3647% -94 - C5 -1BSK 5.3 DEF_ECOLI
29 PsiBlast_CBE 80.3547% -93 - C5 -1XEN 3.5 DEF_ECOLI
66 PsiBlast_CBE 80.3339% -97 - C5 -2EW5 6.7 ?
62 PsiBlast_CBE 80.2639% -96 - C5 -4E9B 6.5 ?
16 PsiBlast_PDB 80.2647% -94 - C5 -1BSJ 5.0 DEF_ECOLI
49 PsiBlast_CBE 80.2347% -97 - C5 -1BS4 4.8 DEF_ECOLI
38 PsiBlast_CBE 80.1947% -96 - C5 -1G27 4.7 DEF_ECOLI
34 PsiBlast_CBE 80.1447% -96 - C5 -1ICJ 4.0 DEF_ECOLI
89 PsiBlast_CBE 80.1033%-118 - C5 -3U04 6.6 ?
22 PsiBlast_CBE 80.0448% -98 - C5 -3K6L 4.5 DEF_ECOLI
50 PsiBlast_CBE 79.9947% -97 - C5 -1BS4 4.5 DEF_ECOLI
28 PsiBlast_CBE 79.9747% -91 - C5 -1XEO 3.5 DEF_ECOLI
8 PsiBlast_PDB 79.9247% -95 - C5 -4AZ4 2.9 ?
33 PsiBlast_CBE 79.7847% -96 - C5 -1ICJ 5.2 DEF_ECOLI
5 PsiBlast_PDB 79.5347% -99 - C5 -4AL2 2.8 DEF_ECOLI
82 PsiBlast_CBE 79.5240% -85 - C5 -1IX1 6.5 DEF_PSEAE
111 HHSearch 79.4944% -84 - C5 -1XEO 3.5 DEF_ECOLI
36 PsiBlast_CBE 79.2147% -97 - C5 -1G2A 6.1 DEF_ECOLI
31 PsiBlast_CBE 79.0647%-100 - C5 -1LRU 5.8 DEF_ECOLI
103 Fugue 78.8043% -89 - C5 -1G2A 5.2 DEF_ECOLI
18 PsiBlast_PDB 78.7847% -93 - C5 -1G27 5.4 DEF_ECOLI
6 PsiBlast_PDB 78.7347% -95 - C5 -2W3T 2.4 DEF_ECOLI
30 PsiBlast_CBE 78.6647% -92 - C5 -1XEM 3.6 DEF_ECOLI
80 PsiBlast_CBE 78.4740% -84 - C5 -1N5N 2.6 DEF_PSEAE
119 HHSearch 77.7444% -89 - C5 -2W3T 2.4 DEF_ECOLI
95 PsiBlast_CBE 77.7438%-105 - C5 -3M6P 5.8 DEF1B_ARATH
96 PsiBlast_CBE 77.6538%-103 - C5 -3M6P 6.1 DEF1B_ARATH
52 PsiBlast_CBE 77.5347%-101 - C5 -2KMN 1.3 DEF_ECOLI
78 PsiBlast_CBE 77.4240% -80 - C5 -1S17 2.3 DEF_PSEAE
129 HHSearch 77.4039% -94 - C5 -4DR8 2.9 ?
69 PsiBlast_CBE 77.3042% -96 - C5 -4DR9 6.5 ?
116 HHSearch 77.2738% -77 - C5 -1N5N 2.6 DEF_PSEAE
100 PsiBlast_CBE 77.1837%-107 - C5 -3M6Q 6.0 DEF1B_ARATH
68 PsiBlast_CBE 77.1642%-102 - C5 -4DR9 6.3 ?
71 PsiBlast_CBE 76.9542% -94 - C5 -4DR8 3.1 ?
113 HHSearch 76.5239% -78 - C5 -3UWB 6.0 ?
73 PsiBlast_CBE 76.4942% -96 - C5 -4DR8 3.3 ?
67 PsiBlast_CBE 76.3042% -93 - C5 -4DR9 6.5 ?
90 PsiBlast_CBE 76.1338%-104 - C5 -3PN4 6.1 DEF1B_ARATH
81 PsiBlast_CBE 75.9440% -82 - C5 -1IX1 6.5 DEF_PSEAE
72 PsiBlast_CBE 75.6742% -95 - C5 -4DR8 3.3 ?
130 HHSearch 75.6037% -81 - C5 -3E3U 6.0 DEF_MYCTU
74 PsiBlast_CBE 75.6042% -97 - C5 -4DR8 2.9 ?
83 PsiBlast_CBE 75.4240% -94 - C5 -1LRY 6.2 DEF_PSEAE
70 PsiBlast_CBE 74.8842% -99 - C5 -4DR9 6.5 ?
121 HHSearch 73.6835% -87 - C5 -1RL4 4.0 ?
94 PsiBlast_CBE 73.1938%-101 - C5 -3O3J 3.8 DEF1B_ARATH
115 HHSearch 72.7532% -93 - C5 -5HGW 2.1 ?
124 HHSearch 70.0335% -82 - C5 -1Y6H 3.4 DEF_LEPIN
85 PsiBlast_CBE 66.5737% -59 - C5 -1RL4 4.2 ?
86 PsiBlast_CBE 66.1337% -63 - C5 -1RL4 4.0 ?