@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu15800: (2016-06-24 )
MKTINIVAGGPKNLIPDLTGYTDEHTLWIGVDKGTVTLLDAGIIPVEAFGDFDSITEQERRRIEKAAPALHVYQAEKDQTDLDLALDWALEKQPDIIQIFGITGGRADHFLGNIQLLYKGVKTNIKIRLIDKQNHIQMFPPGEYDIEKDENKRYISFIPFSEDIHELTLTGFKYPLNNCHITLGSTLCISNELIHSRGTFSFAKGILIMIRSTD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

VIB_C_15(3LM8)
THIN_BACSU
[Raw transfer]




VIB_C_15(3LM8)
THIN_BACSU
[Raw transfer]




VIB_D_17(3LM8)
THIN_BACSU
[Raw transfer]




TPP_A_4(3IHK)
?
[Raw transfer]




TPP_A_5(3MEL)
?
[Raw transfer]




TPP_A_5(3MEL)
?
[Raw transfer]




VIB_A_5(3LM8)
THIN_BACSU
[Raw transfer]




TPP_A_4(3IHK)
?
[Raw transfer]




VIB_B_9(3LM8)
THIN_BACSU
[Raw transfer]




24 HHSearch 95.57100%-148 - C2 -3LM8 2.8 THIN_BACSU
1 PsiBlast_PDB 95.4598%-147 - C2 -3LM8 2.8 THIN_BACSU
21 PsiBlast_CBE 94.7998%-149 - C2 -3LM8 3.1 THIN_BACSU
23 PsiBlast_CBE 94.4198%-146 - C2 -3LM8 2.7 THIN_BACSU
22 PsiBlast_CBE 93.8298%-142 - C2 -3LM8 3.7 THIN_BACSU
2 PsiBlast_PDB 82.8953%-152 - C2 -3K94 - ? -
48 Fugue 71.7023%-148 - C2 -1IG3 - TPK1_MOUSE -
5 PsiBlast_PDB 71.4035%-128 - C2 -3MEL 2.5 ?
26 HHSearch 71.3535%-128 - C2 -3MEL 2.5 ?
4 PsiBlast_PDB 69.6638%-125 - C2 -3CQ9 - ? -
29 HHSearch 68.7832%-122 - C2 -3IHK 2.3 ?
30 HHSearch 67.6523%-142 * C2 *3S4Y - TPK1_HUMAN -
28 HHSearch 67.5438%-118 - C2 -3CQ9 - ? -
6 PsiBlast_PDB 66.4632%-116 - C2 -3IHK 2.3 ?
47 Fugue 64.4136%-109 - C2 -3CQ9 - ? -
32 HHSearch 64.0417%-141 - C2 -1IG0 - THI80_YEAST -
27 HHSearch 63.1443%-107 - C2 -3L8M - ? -
3 PsiBlast_PDB 62.4843% -98 - C2 -3L8M - ? -
49 Fugue 61.8220%-153 - C2 -1IG3 - TPK1_MOUSE -
7 PsiBlast_PDB 58.1426%-149 - C2 -1IG3 - TPK1_MOUSE -