@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu15920: (2016-06-25 )
MADTLERVTKIIVDRLGVDEADVKLEASFKEDLGADSLDVVELVMELEDEFDMEISDEDAEKIATVGDAVNYIQNQQ

Atome Classification :

(35 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PSE_B_12(2FAE)
ACP_ECOLI
[Raw transfer]




1R3_A_5(4KEH)
?
[Raw transfer]




1R3_B_6(4KEH)
?
[Raw transfer]




SXM_B_4(3NY7)
ACP_ECOLI
[Raw transfer]




PM4_A_14(2FAC)
ACP_ECOLI
[Raw transfer]




PM5_A_12(2FAD)
ACP_ECOLI
[Raw transfer]




PM4_B_15(2FAC)
ACP_ECOLI
[Raw transfer]




ZMK_B_6(4ETW)
ACP_SHIF8
[Raw transfer]




ZMK_D_5(4ETW)
ACP_SHIF8
[Raw transfer]




PNS_B_3(5CZD)
?
[Raw transfer]




PNS_A_2(2FQ2)
?
[Raw transfer]




PNS_A_2(2FQ0)
?
[Raw transfer]




PM5_B_13(2FAD)
ACP_ECOLI
[Raw transfer]




PSR_A_11(1L0I)
ACP_ECOLI
[Raw transfer]




PSR_A_11(1L0I)
ACP_ECOLI
[Raw transfer]




PNS_A_2(2M5R)
?
[Raw transfer]




1 PsiBlast_PDB 88.55100%-193 - C7 -2X2B - ACP_BACSU -
5 PsiBlast_PDB 76.5460%-187 - C7 -2EHS - ACP_AQUAE -
57 PsiBlast_CBE 76.1048%-196 - C7 -3GZL - ? -
55 PsiBlast_CBE 75.3548%-172 - C7 -3GZM - ? -
21 PsiBlast_CBE 75.0266%-155 - C7 -4DXE - ACP_STAAC -
40 PsiBlast_CBE 74.1061%-170 - C7 -4IHG - ? -
56 PsiBlast_CBE 74.0748%-165 - C7 -3GZM - ? -
32 PsiBlast_CBE 74.0661%-162 - C7 -4IHH - ? -
41 PsiBlast_CBE 73.7161%-188 - C7 -4IHF - ? -
9 PsiBlast_PDB 73.6861%-151 - C7 -3EJE - ACP_ECOLI -
4 PsiBlast_PDB 73.2866%-174 - C7 -4DXE - ACP_STAAC -
6 PsiBlast_PDB 72.7960%-175 - C7 -2EHT - ACP_AQUAE -
109 HHSearch 72.7662%-159 - C7 -1L0I 3.4 ACP_ECOLI
34 PsiBlast_CBE 72.6661%-162 - C7 -4IHH - ? -
2 PsiBlast_PDB 72.31100%-128 - C7 -1HY8 - ACP_BACSU -
44 PsiBlast_CBE 72.0561%-165 - C7 -4IHF - ? -
8 PsiBlast_PDB 71.9561%-154 - C7 -3EJD - ACP_ECOLI -
16 PsiBlast_PDB 71.7663%-163 - C7 -1T8K - ACP_ECOLI -
26 PsiBlast_CBE 71.7361%-151 - C7 -3EJD - ACP_ECOLI -
13 PsiBlast_PDB 71.4961%-149 - C7 -1L0H - ACP_ECOLI -
15 PsiBlast_PDB 70.9461%-148 - C7 -3NY7 2.9 ACP_ECOLI
47 PsiBlast_CBE 70.0963%-152 - C7 -4KEH 3.4 ?
53 PsiBlast_CBE 69.7759%-137 - C7 -1L0I 3.4 ACP_ECOLI
17 PsiBlast_PDB 68.9563%-143 - C7 -2FAC 5.3 ACP_ECOLI
51 PsiBlast_CBE 68.7663%-150 - C7 -2FAD 3.5 ACP_ECOLI
52 PsiBlast_CBE 68.0263%-149 - C7 -2FAC 5.1 ACP_ECOLI
18 PsiBlast_PDB 67.2063%-138 - C7 -2FAD 4.6 ACP_ECOLI
46 PsiBlast_CBE 66.9863%-158 - C7 -4KEH 3.3 ?
50 PsiBlast_CBE 66.3463%-143 - C7 -2FAE Error ACP_ECOLI
49 PsiBlast_CBE 65.9763%-153 - C7 -4ETW 2.0 ACP_SHIF8
48 PsiBlast_CBE 65.9063%-150 - C7 -4ETW 2.0 ACP_SHIF8
59 PsiBlast_CBE 55.6048% -87 - C7 -2FQ0 2.0 ?
102 HHSearch 53.6746%-149 - C7 -2M5R 2.0 ?
87 Fugue 43.8032%-133 - C7 -5CZD 2.2 ?
58 PsiBlast_CBE 43.1348% -64 - C7 -2FQ2 2.0 ?