@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu15980: (2016-06-25 )
MAFEGLADRLQQTISKIRGKGKVSEQDVKEMMREVRLALLEADVNFKVVKDFVKKVSERAVGQDVMKSLTPGQQVIKVVQEELTELMGGEESKIAVAKRPPTVIMMVGLQGAGKTTTSGKLANLLRKKHNRKPMLVAADIYRPAAIKQLETLGKQLDMPVFSLGDQVSPVEIAKQAIEKAKEEHYDYVILDTAGRLHIDHELMDELTNVKEIANPEEIFLVVDSMTGQDAVNVAKSFNEQLGLTGVVLTKLDGDTRGGAALSIRAVTNTPIKFAGLGEKLDALEPFHPERMASRILGMGDVLTLIEKAQASVDEDKAKELEQKMRTMSFTLDDFLEQLGQVRNMGPLDELLQMMPGAGKMKGLKNIQVDEKQLNHVEAIIKSMTVLEKEQPDIINASRRKRIAKGSGTSVQEVNRLLKQFDEMKKMMKQMTNMSKGKKKGFKLPFM

Atome Classification :

(34 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GDP_B_17(3DM5)
SRP54_PYRFU
[Raw transfer]




GDP_B_11(4C7O)
FTSY_ECOLI
[Raw transfer]




GCP_D_17(1OKK)
FTSY_THEAQ
[Raw transfer]




GDP_D_17(4C7O)
FTSY_ECOLI
[Raw transfer]




GOL_B_14(3DMD)
?
[Raw transfer]




GNP_K_11(2Q9C)
FTSY_THEAQ
[Raw transfer]




GNP_B_20(2J7P)
FTSY_THEAQ
[Raw transfer]




GCP_B_6(1RJ9)
FTSY_THEAQ
[Raw transfer]




CIT_B_4(1VMA)
?
[Raw transfer]




GCP_A_3(1OKK)
FTSY_THEAQ
[Raw transfer]




GNP_T_20(2Q9B)
FTSY_THEAQ
[Raw transfer]




GDP_B_11(4C7O)
SRP54_ECOLI
[Raw transfer]




GDP_D_2(2IYL)
FTSY_THEAQ
[Raw transfer]




GNP_A_12(2J7P)
FTSY_THEAQ
[Raw transfer]




EDO_A_2(2YHS)
FTSY_ECOLI
[Raw transfer]




OXY_A_5(1LS1)
SRP54_THEAQ
[Raw transfer]




21 PsiBlast_CBE 87.7954%-106 - C8 -2XXA - SRP54_ECOLI -
1 PsiBlast_PDB 87.0054% -99 - C8 -2XXA - SRP54_ECOLI -
40 PsiBlast_CBE 81.1639%-108 - C8 -3DM5 - SRP54_PYRFU -
39 PsiBlast_CBE 81.0539%-111 - C8 -3DM5 - SRP54_PYRFU -
81 HHSearch 80.7738%-105 - C8 -3DM5 Error SRP54_PYRFU
23 PsiBlast_CBE 80.4150% -92 - C7 -2FFH - SRP54_THEAQ -
24 PsiBlast_CBE 80.3156%-109 - C8 -4C7O - SRP54_ECOLI -
26 PsiBlast_CBE 79.8352%-123 - C8 -2J46 - SRP54_THEAQ -
11 PsiBlast_PDB 79.6052%-123 - C8 -2J45 - SRP54_THEAQ -
12 PsiBlast_PDB 79.5652%-123 - C8 -2J46 - SRP54_THEAQ -
3 PsiBlast_PDB 79.3746% - - C8 -2IY3 - SRP54_SULSO (first) -
80 HHSearch 79.2949% -91 - C7 -2FFH - SRP54_THEAQ -
10 PsiBlast_PDB 78.9452%-117 - C8 -2C04 - SRP54_THEAQ -
2 PsiBlast_PDB 78.8550% -90 - C7 -2FFH - SRP54_THEAQ -
8 PsiBlast_PDB 78.7952%-118 - C8 -2C03 - SRP54_THEAQ -
25 PsiBlast_CBE 78.3552%-119 - C8 -2C03 - SRP54_THEAQ -
14 PsiBlast_PDB 78.3352%-116 - C8 -1JPN - SRP54_THEAQ -
22 PsiBlast_CBE 78.3150% -89 - C7 -2FFH - SRP54_THEAQ -
27 PsiBlast_CBE 78.2652%-121 - C8 -2J45 - SRP54_THEAQ -
4 PsiBlast_PDB 78.0456%-108 - C8 -4C7O - SRP54_ECOLI -
85 HHSearch 77.3756%-107 - C8 -4C7O 3.0 SRP54_ECOLI
92 HHSearch 76.4051%-120 - C8 -1LS1 2.8 SRP54_THEAQ
98 HHSearch 69.8534%-124 - C8 -2YHS 2.9 FTSY_ECOLI
43 PsiBlast_CBE 68.4237%-120 - C8 -3DMD 2.6 ?
64 PsiBlast_CBE 60.8041%-119 - C8 -1VMA 3.9 ?
48 PsiBlast_CBE 58.4735% -99 - C8 -4C7O 7.2 FTSY_ECOLI
60 PsiBlast_CBE 57.4142%-125 - C8 -2IYL 5.2 FTSY_THEAQ
49 PsiBlast_CBE 57.2835% -96 - C8 -4C7O 7.0 FTSY_ECOLI
53 PsiBlast_CBE 56.5642%-113 - C8 -2Q9C 5.0 FTSY_THEAQ
58 PsiBlast_CBE 56.5142%-104 - C8 -2J7P 2.9 FTSY_THEAQ
51 PsiBlast_CBE 56.0842%-106 - C8 -1OKK 7.4 FTSY_THEAQ
55 PsiBlast_CBE 55.9342%-116 - C8 -2Q9B 4.4 FTSY_THEAQ
59 PsiBlast_CBE 55.0642%-106 - C8 -2J7P 2.9 FTSY_THEAQ
66 PsiBlast_CBE 53.7841%-105 - C8 -1RJ9 2.9 FTSY_THEAQ