@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu16030: (2016-06-25 )
MKIDFLTLFPEMFEGVLGSSILQKAQEKDAVQFQVVNFREYSDNKHNTVDDYPYGGGAGMVLKPQPVFDAVEDLTSKAAAAPRIILVCPQGERFTQKKAEQLAKEEHLLFICGHYEGYDERIREHLVTDEISIGDFVLTGGELPAMMIADSVVRLLPGVLGKEASHIEDSFSTGLLEHPHYTRPADYKGLKVPETLLSGNHAKIEEWRNKESIRRTYLRRPDLLKDHPLTEQQRKWISEWEKE

Atome Classification :

(57 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SFG_B_5(4YVI)
TRMD_HAEIN
[Raw transfer]




SAH_A_2(1P9P)
TRMD_ECOLI
[Raw transfer]




SAM_C_3(1UAK)
TRMD_HAEIN
[Raw transfer]




4GX_A_2(4YQI)
?
[Raw transfer]




SAH_C_3(1UAL)
TRMD_HAEIN
[Raw transfer]




SAH_C_3(1UAL)
TRMD_HAEIN
[Raw transfer]




SFG_A_2(4YVH)
TRMD_HAEIN
[Raw transfer]




SFG_A_4(4YVI)
TRMD_HAEIN
[Raw transfer]




SAH_E_5(1UAM)
TRMD_HAEIN
[Raw transfer]




SAH_A_3(4H3Y)
TRMD_BURP8
[Raw transfer]




SAM_A_2(4YVG)
TRMD_HAEIN
[Raw transfer]




SFG_B_5(4YVK)
TRMD_HAEIN
[Raw transfer]




4GT_A_2(4YQJ)
?
[Raw transfer]




4G0_A_2(4YQ5)
?
[Raw transfer]




4H7_A_2(4YQQ)
?
[Raw transfer]




4GY_A_2(4YQG)
?
[Raw transfer]




SFG_B_5(4YVJ)
TRMD_HAEIN
[Raw transfer]




4H8_A_2(4YQT)
?
[Raw transfer]




ADN_A_2(3AXZ)
TRMD_HAEIN
[Raw transfer]




SFG_A_4(4YVK)
TRMD_HAEIN
[Raw transfer]




4G3_A_2(4YQ4)
?
[Raw transfer]




SAH_A_3(4H3Z)
TRMD_BURP8
[Raw transfer]




SAH_A_3(4H3Z)
TRMD_BURP8
[Raw transfer]




SFG_A_4(4YVJ)
TRMD_HAEIN
[Raw transfer]




SAH_A_2(4IG6)
TRMD_ANAPZ
[Raw transfer]




4GN_A_2(4YQA)
?
[Raw transfer]




EFW_A_2(4YQC)
?
[Raw transfer]




4G4_A_2(4YQ7)
?
[Raw transfer]




4GM_A_2(4YQB)
?
[Raw transfer]




SAH_B_6(4H3Z)
TRMD_BURP8
[Raw transfer]




4FD_A_2(4YPW)
?
[Raw transfer]




4H1_A_2(4YQO)
?
[Raw transfer]




21W_B_8(4MCB)
TRMD_HAEIN
[Raw transfer]




4H4_A_2(4YQL)
?
[Raw transfer]




4GO_A_2(4YQ9)
?
[Raw transfer]




21X_A_3(4MCC)
TRMD_HAEIN
[Raw transfer]




4H6_A_2(4YQP)
?
[Raw transfer]




21X_B_4(4MCC)
TRMD_HAEIN
[Raw transfer]




4GS_A_2(4YQK)
?
[Raw transfer]




4GZ_A_2(4YQD)
TRMD_HAEIN
[Raw transfer]




4H3_A_2(4YQN)
?
[Raw transfer]




4FM_A_2(4YQ0)
?
[Raw transfer]




4GZ_A_2(4YQD)
TRMD_HAEIN
[Raw transfer]




4FX_A_2(4YQ6)
?
[Raw transfer]




22L_A_2(4MCD)
TRMD_HAEIN
[Raw transfer]




4H9_A_2(4YQS)
?
[Raw transfer]




21W_A_5(4MCB)
TRMD_HAEIN
[Raw transfer]




4G1_A_2(4YQ3)
?
[Raw transfer]




4FN_A_2(4YQ1)
?
[Raw transfer]




EFY_A_2(4YQ2)
?
[Raw transfer]




4FG_A_2(4YPX)
?
[Raw transfer]




4FL_A_2(4YPZ)
?
[Raw transfer]




4F9_A_2(4YPY)
?
[Raw transfer]




EDO_A_3(3QUV)
?
[Raw transfer]




EDO_B_6(3QUV)
?
[Raw transfer]




EDO_A_3(3QUV)
?
[Raw transfer]




22 PsiBlast_CBE 78.1746%-144 - C9 -4MCB 6.3 TRMD_HAEIN
23 PsiBlast_CBE 76.7546%-142 - C9 -4YVK 5.5 TRMD_HAEIN
44 PsiBlast_CBE 76.4946%-146 - C9 -4YQ4 6.2 ?
25 PsiBlast_CBE 76.3946%-142 - C9 -4YVI 6.6 TRMD_HAEIN
24 PsiBlast_CBE 76.3646%-141 - C9 -4YVJ 5.2 TRMD_HAEIN
9 PsiBlast_PDB 76.2346%-150 - C9 -4YVG 7.0 TRMD_HAEIN
45 PsiBlast_CBE 76.2246%-149 - C9 -4YQ3 7.6 ?
35 PsiBlast_CBE 76.0446%-154 - C9 -4YQI 5.0 ?
33 PsiBlast_CBE 76.0446%-155 - C9 -4YQK 4.0 ?
4 PsiBlast_PDB 76.0346%-139 - C9 -1UAM 6.3 TRMD_HAEIN
11 PsiBlast_PDB 75.9746%-149 - C9 -4YVI 6.4 TRMD_HAEIN
29 PsiBlast_CBE 75.7746%-153 - C9 -4YQP 5.6 ?
34 PsiBlast_CBE 75.7646%-157 - C9 -4YQJ 4.8 ?
15 PsiBlast_PDB 75.6646%-157 - C9 -4YPW 5.3 ?
27 PsiBlast_CBE 75.6446%-153 - C9 -4YQS 5.1 ?
19 PsiBlast_PDB 75.6146%-157 - C9 -4YQ0 4.9 ?
40 PsiBlast_CBE 75.5746%-148 - C9 -4YQ9 6.1 ?
38 PsiBlast_CBE 75.5646%-148 - C9 -4YQB 6.2 ?
42 PsiBlast_CBE 75.5446%-151 - C9 -4YQ6 6.3 ?
30 PsiBlast_CBE 75.5146%-152 - C9 -4YQO 6.4 ?
1 PsiBlast_PDB 75.5146%-154 - C9 -1UAJ - TRMD_HAEIN -
47 PsiBlast_CBE 75.4346%-152 - C9 -1P9P 5.6 TRMD_ECOLI
31 PsiBlast_CBE 75.4346%-155 - C9 -4YQN 5.0 ?
10 PsiBlast_PDB 75.4346%-149 - C9 -4YVH 6.2 TRMD_HAEIN
41 PsiBlast_CBE 75.2846%-150 - C9 -4YQ7 6.6 ?
39 PsiBlast_CBE 75.2346%-151 - C9 -4YQA 5.7 ?
32 PsiBlast_CBE 75.2046%-151 - C9 -4YQL 4.2 ?
55 Fugue 75.1944%-154 - C9 -1UAL 5.5 TRMD_HAEIN
21 PsiBlast_CBE 75.1346%-158 - C9 -4MCC 6.0 TRMD_HAEIN
37 PsiBlast_CBE 75.1246%-155 - C9 -4YQC 5.8 ?
36 PsiBlast_CBE 75.1146%-154 - C9 -4YQG 4.2 ?
26 PsiBlast_CBE 74.9946%-154 - C9 -4YQT 5.3 ?
18 PsiBlast_PDB 74.9946%-152 - C9 -4YPZ 4.0 ?
65 HHSearch 74.9346%-145 - C9 -4YQD 8.3 TRMD_HAEIN
14 PsiBlast_PDB 74.9346%-145 - C9 -4YQD 8.3 TRMD_HAEIN
3 PsiBlast_PDB 74.6346%-154 - C9 -1UAL 5.5 TRMD_HAEIN
46 PsiBlast_CBE 74.6146%-149 - C9 -4YQ2 7.8 ?
2 PsiBlast_PDB 74.1746%-153 - C9 -1UAK 7.0 TRMD_HAEIN
16 PsiBlast_PDB 73.9946%-152 - C9 -4YPX 4.4 ?
8 PsiBlast_PDB 73.9746%-156 - C9 -3AXZ 4.7 TRMD_HAEIN
17 PsiBlast_PDB 73.8346%-148 - C9 -4YPY 4.3 ?
20 PsiBlast_PDB 73.6346%-146 - C9 -4YQ1 8.2 ?
7 PsiBlast_PDB 73.5946%-153 - C9 -4MCD 4.8 TRMD_HAEIN
13 PsiBlast_PDB 73.5346%-146 - C9 -4YVK 6.8 TRMD_HAEIN
12 PsiBlast_PDB 73.4646%-147 - C9 -4YVJ 6.6 TRMD_HAEIN
51 PsiBlast_CBE 72.6340%-159 - C9 -4H3Y 6.1 TRMD_BURP8
67 HHSearch 72.4542%-153 * C9 *4H3Z 6.4 TRMD_BURP8
49 PsiBlast_CBE 72.1340%-156 - C9 -4H3Z 6.4 TRMD_BURP8
43 PsiBlast_CBE 71.4446%-150 - C9 -4YQ5 7.1 ?
53 PsiBlast_CBE 71.4345%-159 - C9 -3QUV 2.8 ?
48 PsiBlast_CBE 71.1840%-152 - C9 -4H3Z 5.3 TRMD_BURP8
28 PsiBlast_CBE 71.1146%-153 - C9 -4YQQ 7.3 ?
54 PsiBlast_CBE 70.3645%-170 - C9 -3QUV 2.9 ?
52 PsiBlast_CBE 69.0645%-162 - C9 -4IG6 6.2 TRMD_ANAPZ
6 PsiBlast_PDB 68.6146%-162 - C9 -4MCC 6.1 TRMD_HAEIN
70 HHSearch 68.0345%-160 - C9 -3QUV 2.9 ?
5 PsiBlast_PDB 68.0246%-160 - C9 -4MCB 6.2 TRMD_HAEIN