@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu16050: (2016-06-25 )
MTIQWFPGHMAKARREVTEKLKLIDIVYELVDARIPMSSRNPMIEDILKNKPRIMLLNKADKADAAVTQQWKEHFENQGIRSLSINSVNGQGLNQIVPASKEILQEKFDRMRAKGVKPRAIRALIIGIPNVGKSTLINRLAKKNIAKTGDRPGITTSQQWVKVGKELELLDTPGILWPKFEDELVGLRLAVTGAIKDSIINLQDVAVFGLRFLEEHYPERLKERYGLDEIPEDIAELFDAIGEKRGCLMSGGLINYDKTTEVIIRDIRTEKFGRLSFEQPTM

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GNP_A_3(1PUJ)
RBGA_BACSU
[Raw transfer]




GNP_A_2(3CNL)
RBGA_THEMA
[Raw transfer]




GNP_A_3(1PUJ)
RBGA_BACSU
[Raw transfer]




GNP_A_3(1PUJ)
RBGA_BACSU
[Raw transfer]




GTP_A_2(3CNN)
RBGA_THEMA
[Raw transfer]




GDP_A_2(3CNO)
RBGA_THEMA
[Raw transfer]




GNP_A_2(3CNL)
RBGA_THEMA
[Raw transfer]




DGI_A_2(3H2Y)
?
[Raw transfer]




112 HHSearch 77.65100%-116 - C11 -1PUJ 7.5 RBGA_BACSU
1 PsiBlast_PDB 77.65100%-116 - C11 -1PUJ 7.5 RBGA_BACSU
102 Fugue 77.2099%-113 - C11 -1PUJ 7.5 RBGA_BACSU
2 PsiBlast_PDB 46.9931% -98 - C11 -3CNL 7.2 RBGA_THEMA
4 PsiBlast_PDB 46.8931%-102 - C11 -3CNO 7.5 RBGA_THEMA
3 PsiBlast_PDB 46.8131%-103 - C11 -3CNN 7.3 RBGA_THEMA
113 HHSearch 46.0933% -93 - C11 -3CNL 7.2 RBGA_THEMA
123 HHSearch 42.0926%-150 * C11 *2RCN - RSGA_SALTY -
64 PsiBlast_CBE 40.4265%-217 - C7 -2DBY - ? -
117 HHSearch 39.5621%-126 - C11 -2YV5 - RSGA_AQUAE -
115 HHSearch 35.6826%-111 - C11 -3EC1 - ? -
118 HHSearch 35.4322% -98 - C11 -1U0L - RSGA_THEMA -
114 HHSearch 34.8829%-108 - C11 -3H2Y 4.9 ?
130 HHSearch 33.6645%-155 - C10 -1MKY - DER_THEMA -
86 PsiBlast_CBE 33.1135%-149 - C15 -4HNU - ? -
88 PsiBlast_CBE 32.9535%-155 - C15 -4HNV - ? -
94 PsiBlast_CBE 32.7135%-156 - C15 -4HNT - ? -
101 PsiBlast_CBE 32.6235%-163 - C15 -3HBL - ? -
90 PsiBlast_CBE 32.4435%-159 - C15 -4HNV - ? -
103 Fugue 32.0920% -88 - C11 -3EC1 - ? -