@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu16330: (2016-06-25 )
MAHRILIVDDAAFMRMMIKDILVKNGFEVVAEAENGAQAVEKYKEHSPDLVTMDITMPEMDGITALKEIKQIDAQARIIMCSAMGQQSMVIDAIQAGAKDFIVKPFQADRVLEAINKTLN

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

IMD_A_5(5DKF)
?
[Raw transfer]




IMD_A_5(5DGC)
?
[Raw transfer]




IMD_B_13(5DKF)
?
[Raw transfer]




IMD_A_5(5D2C)
?
[Raw transfer]




IMD_B_12(5DGC)
?
[Raw transfer]




GOL_A_5(3OLX)
CHEY_ECOLI
[Raw transfer]




IMD_B_13(5D2C)
?
[Raw transfer]




WO4_B_16(3RVS)
CHEY_ECOLI
[Raw transfer]




WO4_A_4(3RVS)
CHEY_ECOLI
[Raw transfer]




22 PsiBlast_CBE 85.9572%-134 - C1 -3TMY - CHEY_THEMA -
3 PsiBlast_PDB 85.1772%-150 - C1 -1TMY - CHEY_THEMA -
6 PsiBlast_PDB 84.8072%-150 - C- -1U0S - CHEY_THEMA -
4 PsiBlast_PDB 84.3672%-150 - C1 -2TMY - CHEY_THEMA -
21 PsiBlast_CBE 83.4572%-127 - C1 -4TMY - CHEY_THEMA -
1 PsiBlast_PDB 83.3272%-124 - C1 -3TMY - CHEY_THEMA -
7 PsiBlast_PDB 82.5770%-137 - C1 -4QYW - CHEY_THEMA -
107 HHSearch 82.3071%-142 - C1 -4QYW - CHEY_THEMA -
5 PsiBlast_PDB 82.1972%-118 - C1 -4IGA - CHEY_THEMA -
2 PsiBlast_PDB 81.6772%-120 - C1 -4TMY - CHEY_THEMA -
25 PsiBlast_CBE 78.4036%-158 - C1 -1SRR - SP0F_BACSU -
26 PsiBlast_CBE 78.2136%-155 - C1 -1PEY - SP0F_BACSU -
31 PsiBlast_CBE 77.6636%-171 - C1 -1F51 - SP0F_BACSU -
20 PsiBlast_PDB 77.4736%-153 - C1 -1FSP - SP0F_BACSU -
19 PsiBlast_PDB 76.7436%-151 - C1 -1PUX - SP0F_BACSU -
29 PsiBlast_CBE 76.4036%-165 - C1 -1F51 - SP0F_BACSU -
30 PsiBlast_CBE 76.3536%-164 - C1 -1F51 - SP0F_BACSU -
17 PsiBlast_PDB 74.3336%-165 - C1 -1PEY - SP0F_BACSU -
8 PsiBlast_PDB 73.4671%-123 - C1 -4QWV - -
16 PsiBlast_PDB 73.2836%-156 - C1 -1SRR - SP0F_BACSU -
78 PsiBlast_CBE 66.3437%-130 - C1 -3RVS 2.8 CHEY_ECOLI
77 PsiBlast_CBE 65.6437%-130 - C1 -3RVS 2.7 CHEY_ECOLI
97 PsiBlast_CBE 65.1736%-125 - C1 -3OLX 2.9 CHEY_ECOLI
37 PsiBlast_CBE 64.9237%-134 - C1 -5DKF 3.6 ?
38 PsiBlast_CBE 64.4437%-133 - C1 -5DKF 3.6 ?
40 PsiBlast_CBE 64.3137%-131 - C1 -5DGC 3.7 ?
41 PsiBlast_CBE 64.2137%-136 - C1 -5D2C 3.7 ?
39 PsiBlast_CBE 64.0337%-127 - C1 -5DGC 3.5 ?
42 PsiBlast_CBE 63.9937%-132 - C1 -5D2C 3.5 ?