@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu16750: (2016-06-26 )
MGRGLHVAVVGATGAVGQQMLKTLEDRNFEMDTLTLLSSKRSAGTKVTFKGQELTVQEASPESFEGVNIALFSAGGSVSQALAPEAVKRGAIVIDNTSAFRMDENTPLVVPEVNEADLHEHNGIIANPNCSTIQMVAALEPIRKAYGLNKVIVSTYQAVSGAGNEAVKELYSQTQAILNKEEIEPEIMPVKGDKKHYQIAFNAIPQIDKFQDNGYTFEEMKMINETKKIMHMPDLQVAATCVRLPIQTGHSESVYIEIDRDDATVEDIKNLLKEAPGVTLQDDPSQQLYPMPADAVGKNDVFVGRIRKDLDRANGFHLWVVSDNLLKGAAWNSVQIAESLKKLNLV

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

3JL_A_3(4R4J)
?
[Raw transfer]




3JN_A_9(4R5H)
?
[Raw transfer]




11C_A_3(3PWS)
?
[Raw transfer]




3JL_B_9(4R4J)
?
[Raw transfer]




3GQ_B_13(4R3N)
?
[Raw transfer]




12T_B_13(3PYX)
?
[Raw transfer]




NAP_B_11(4R4J)
?
[Raw transfer]




3GQ_A_6(4R3N)
?
[Raw transfer]




3JM_A_7(4R54)
?
[Raw transfer]




GOL_A_2(3VOS)
DHAS_MYCTU
[Raw transfer]




4NO_B_13(4R41)
?
[Raw transfer]




11C_B_6(3PWS)
?
[Raw transfer]




4NO_A_3(4R41)
?
[Raw transfer]




NAP_A_10(4R5H)
?
[Raw transfer]




NAP_A_5(4R3N)
?
[Raw transfer]




NAP_B_12(4R3N)
?
[Raw transfer]




NAP_A_4(4R4J)
?
[Raw transfer]




NAP_A_6(4R51)
?
[Raw transfer]




NAP_A_5(4R3N)
?
[Raw transfer]




NAP_A_4(3PZB)
?
[Raw transfer]




NAP_A_5(4R54)
?
[Raw transfer]




NAP_B_9(3PZB)
?
[Raw transfer]




NAP_A_3(3PYX)
?
[Raw transfer]




NAP_B_9(3PYX)
?
[Raw transfer]




MLA_A_7(1YS4)
DHAS_METJA
[Raw transfer]




NAP_B_15(4R51)
?
[Raw transfer]




NAP_B_15(4R5H)
?
[Raw transfer]




NAP_B_9(4R54)
?
[Raw transfer]




NAP_B_9(3Q11)
?
[Raw transfer]




NAP_B_14(4R41)
?
[Raw transfer]




2RA_B_8(3PZB)
?
[Raw transfer]




NAP_A_4(4R41)
?
[Raw transfer]




2RA_A_3(3PZB)
?
[Raw transfer]




NAP_A_3(3Q11)
?
[Raw transfer]




A2P_B_7(3PWS)
?
[Raw transfer]




A2P_A_5(3PWS)
?
[Raw transfer]




25A_B_10(3PWK)
?
[Raw transfer]




CYS_A_2(3TZ6)
DHAS_MYCTU
[Raw transfer]




A2P_B_16(4R3W)
?
[Raw transfer]




CYS_A_2(3TZ6)
DHAS_MYCTU
[Raw transfer]




A2P_A_8(4R3W)
?
[Raw transfer]




25A_A_3(3PWK)
?
[Raw transfer]




DIO_A_8(2HJS)
USG_PSEAE
[Raw transfer]




DIO_A_8(2HJS)
USG_PSEAE
[Raw transfer]




37 PsiBlast_CBE 80.9457% -92 - C2 -3PWK 7.2 ?
22 PsiBlast_CBE 80.8857% -91 - C2 -4R54 7.0 ?
16 PsiBlast_PDB 80.8757% -93 - C2 -4R51 10.4 ?
31 PsiBlast_CBE 80.8157% -89 - C2 -3Q11 8.2 ?
34 PsiBlast_CBE 80.6757% -93 - C2 -3PYL - ? -
36 PsiBlast_CBE 80.5857% -92 - C2 -3PWS 6.4 ?
27 PsiBlast_CBE 80.5657% -92 - C2 -4R3N 10.2 ?
23 PsiBlast_CBE 80.5257% -92 - C2 -4R51 7.8 ?
15 PsiBlast_PDB 80.5157% -88 - C2 -4R4J 10.9 ?
7 PsiBlast_PDB 80.5057% -92 - C2 -3PYL - ? -
35 PsiBlast_CBE 80.4357% -94 - C2 -3PYL - ? -
10 PsiBlast_PDB 80.3957% -91 - C2 -3Q11 7.5 ?
5 PsiBlast_PDB 80.3857% -91 - C2 -3PWK 6.3 ?
14 PsiBlast_PDB 80.3757% -90 - C2 -4R41 8.2 ?
17 PsiBlast_PDB 80.3157% -92 - C2 -4R54 11.1 ?
29 PsiBlast_CBE 80.2857% -93 - C2 -3Q1L - ? -
1 PsiBlast_PDB 80.1857% -93 - C2 -2GYY - ? -
13 PsiBlast_PDB 80.1757% -91 - C2 -4R3W 6.6 ?
21 PsiBlast_CBE 80.0757% -91 - C2 -4R5H 8.2 ?
32 PsiBlast_CBE 80.0457% -90 - C2 -3PZB 11.3 ?
12 PsiBlast_PDB 80.0357% -92 - C2 -4R3N 11.1 ?
18 PsiBlast_PDB 80.0057% -90 - C2 -4R5H 10.3 ?
6 PsiBlast_PDB 79.9257% -91 - C2 -3PWS 6.5 ?
24 PsiBlast_CBE 79.8257% -90 - C2 -4R4J 10.4 ?
26 PsiBlast_CBE 79.6157% -90 - C2 -4R3W 5.3 ?
33 PsiBlast_CBE 79.5857% -87 - C2 -3PYX 11.3 ?
9 PsiBlast_PDB 79.4257% -89 - C2 -3PZB 10.8 ?
68 HHSearch 79.3058% -92 * C2 *4R3N 11.1 ?
25 PsiBlast_CBE 79.2257% -88 - C2 -4R41 7.8 ?
8 PsiBlast_PDB 78.9057% -87 - C2 -3PYX 10.5 ?
44 PsiBlast_CBE 68.3241% -87 - C2 -3TZ6 2.7 DHAS_MYCTU
43 PsiBlast_CBE 67.2140% -87 - C2 -3VOS 2.4 DHAS_MYCTU
59 HHSearch 66.8343% -83 - C2 -3TZ6 2.7 DHAS_MYCTU
67 HHSearch 63.4531%-106 - C2 -2HJS 2.1 USG_PSEAE
49 Fugue 62.8530%-111 - C2 -2HJS 2.1 USG_PSEAE
72 HHSearch 53.9934% -69 - C2 -1YS4 3.8 DHAS_METJA