@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu17140: (2016-06-27 )
MTKCNLPEVVVTGVGVTASIGQGKEDFASSLLSGRHAFDVMKRSGRQKDSRFIGAEIASLSYPDRLSKKMLRKASFSSRAALVTLTEAWEEAELDDADSSRIGLVVGGSNFQQRENFEVYERYQDRSGFISPAYGLSFMDSDLCGICTDQFGITGLAYTVGGASASGQLAVIHAIQQVLSGEVDTCIALGALMDLSYMECEALRALGAMGTDKYADEPENACRPFDQNRDGFIYGESCGALVIERKETALRRGLKPYAALSGWSIKLDGNRNPDPSLEGEIHVIQKALERARLLPEDIDYINPHGTGSFIGDEIELKALRACRLSHAYINATKSITGHGLSAAGIVEIISVLLQMKKSALHPSRNLDHPIDDSFHWVNEKSISYRIKNALSLSMGFGGMNTAVCIQNIEKCGGES

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TLJ_B_14(4C70)
?
[Raw transfer]



TLM_B_9(4C6X)
?
[Raw transfer]



TLE_B_15(4C6Z)
?
[Raw transfer]



TLM_A_5(4C6X)
?
[Raw transfer]



TLJ_A_9(4C70)
?
[Raw transfer]



TLE_A_6(4C6Z)
?
[Raw transfer]



EDO_A_7(4C6U)
?
[Raw transfer]
5 PsiBlast_PDB 94.2831% -80 - C3 -1J3N - ? -
2 PsiBlast_PDB 93.7929% -74 - C3 -4LS5 - FABF_BACSU -
3 PsiBlast_PDB 93.0929% -72 - C3 -4LS7 - FABF_BACSU -
21 PsiBlast_CBE 93.0731% -80 - C3 -1J3N - ? -
9 PsiBlast_PDB 93.0430% -78 - C3 -1DD8 - FABB_ECOLI -
13 PsiBlast_PDB 92.7229% -78 - C3 -1G5X - FABB_ECOLI -
4 PsiBlast_PDB 92.6329% -73 - C3 -4LS8 - FABF_BACSU -
11 PsiBlast_PDB 92.6029% -79 - C3 -1FJ4 - FABB_ECOLI -
12 PsiBlast_PDB 92.4229% -79 - C3 -1FJ8 - FABB_ECOLI -
14 PsiBlast_PDB 92.3729% -79 - C3 -2BUH - FABB_ECOLI -
1 PsiBlast_PDB 91.9829% -73 - C3 -4LS6 - FABF_BACSU -
18 PsiBlast_PDB 91.8829% -78 - C3 -2VB7 - FABB_ECOLI -
16 PsiBlast_PDB 91.7029% -78 - C3 -2AQ7 - FABB_ECOLI -
15 PsiBlast_PDB 91.4429% -77 * C3 *2BUI - FABB_ECOLI -
6 PsiBlast_PDB 91.3830% -70 - C3 -2GQD - FABF_STAAC (first) -
17 PsiBlast_PDB 91.1929% -77 - C3 -2AQB - FABB_ECOLI -
20 PsiBlast_PDB 91.0929% -76 - C3 -2VB9 - FABB_ECOLI -
86 HHSearch 89.7528% -75 - C3 -3KZU - ? -
76 HHSearch 89.5328% -70 - C3 -4LS6 - FABF_BACSU -
80 HHSearch 88.1628% -76 - C3 -3MQD - ? -
50 PsiBlast_CBE 78.6731% -80 - C3 -4C6X 4.7 ?
48 PsiBlast_CBE 78.6331% -81 - C3 -4C6Z 5.5 ?
46 PsiBlast_CBE 78.3631% -80 - C3 -4C70 5.3 ?
47 PsiBlast_CBE 78.3331% -80 - C3 -4C70 5.3 ?
51 PsiBlast_CBE 78.1931% -79 - C3 -4C6X 4.8 ?
49 PsiBlast_CBE 78.1731% -80 - C3 -4C6Z 5.5 ?
57 PsiBlast_CBE 77.9231% -82 - C3 -4C6U 3.1 ?