@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu17600: (2016-06-28 )
MAQSHSSSINYFGSANKVVYEGKDSTNPLAFKYYNPQEVIGGKTLKEHLRFSIAYWHTFTADGTDVFGAATMQRPWDHYKGMDLAKMRVEAAFEMFEKLDAPFFAFHDRDIAPEGSTLKETNQNLDMIMGMIKDYMRNSGVKLLWNTANMFTNPRFVHGAATSCNADVFAYAAAQVKKGLETAKELGAENYVFWGGREGYETLLNTDLKFELDNLARFMHMAVDYAKEIGYTGQFLIEPKPKEPTTHQYDTDAATTIAFLKQYGLDNHFKLNLEANHATLAGHTFEHELRMARVHGLLGSVDANQGHPLLGWDTDEFPTDLYSTTLAMYEILQNGGLGSGGLNFDAKVRRSSFEPDDLIYAHIAGMDAFARGLKVAHKLIEDRVFEDVIQHRYRSFTEGIGLEIIEGRANFHTLEQYALNHKSIKNESGRQEKLKAILNQYILEV

Atome Classification :

(75 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

XYL_A_4(4DUO)
XYLA_STRRU
[Raw transfer]




03W_A_2(3U3H)
XYLA_STRRU
[Raw transfer]




XYL_A_3(1XLD)
XYLA_ARTS7
[Raw transfer]




GLC_A_4(4ZB2)
?
[Raw transfer]




32O_A_4(4QEH)
XYLA_STRRU
[Raw transfer]




XYL_A_2(2XIS)
XYLA_STRRU
[Raw transfer]




XYL_A_3(1XLC)
XYLA_ARTS7
[Raw transfer]




GLC_A_9(4ZBC)
?
[Raw transfer]




GLC_A_4(4ZB5)
?
[Raw transfer]




XYL_B_4(1XLG)
XYLA_ARTS7
[Raw transfer]




GLC_A_4(3KBM)
XYLA_STRRU
[Raw transfer]




GCO_A_3(1XLF)
XYLA_ARTS7
[Raw transfer]




RUU_A_4(4QE5)
XYLA_STRRU
[Raw transfer]




XYL_A_3(1XLJ)
XYLA_ARTS7
[Raw transfer]




XYL_A_3(1XLG)
XYLA_ARTS7
[Raw transfer]




XYL_B_4(1XLD)
XYLA_ARTS7
[Raw transfer]




34V_A_4(4QE4)
XYLA_STRRU
[Raw transfer]




GLO_A_5(3KBN)
XYLA_STRRU
[Raw transfer]




XYL_B_4(1XLC)
XYLA_ARTS7
[Raw transfer]




XYL_B_4(1XLJ)
XYLA_ARTS7
[Raw transfer]




GCO_B_4(1XLF)
XYLA_ARTS7
[Raw transfer]




RUU_A_4(4QE1)
XYLA_STRRU
[Raw transfer]




XYL_A_3(1XLM)
XYLA_ARTS7
[Raw transfer]




SUGAR_A_2(4XIS)
XYLA_STRRU
[Raw transfer]

-

GLC_A_8(4ZB0)
?
[Raw transfer]




DIG_A_3(1DID)
XYLA_ARTS7
[Raw transfer]




DIG_B_4(1DID)
XYLA_ARTS7
[Raw transfer]




LAI_A_5(4QDW)
XYLA_STRRU
[Raw transfer]




TRS_A_4(1MNZ)
XYLA_STRRU
[Raw transfer]




TRS_B_16(1O1H)
XYLA_STRRU
[Raw transfer]




NOJ_A_7(1DIE)
XYLA_ARTS7
[Raw transfer]




TRS_A_15(1O1H)
XYLA_STRRU
[Raw transfer]




XYL_B_4(1XLM)
XYLA_ARTS7
[Raw transfer]




GLC_B_15(4ZB0)
?
[Raw transfer]




GLT_B_4(1XLI)
XYLA_ARTS7
[Raw transfer]




EDO_A_2(4A8L)
XYLA_STRRU
[Raw transfer]




Z6J_A_4(4QEE)
XYLA_STRRU
[Raw transfer]




EDO_A_2(4A8I)
XYLA_STRRU
[Raw transfer]




GOL_A_4(2GLK)
XYLA_STRRU
[Raw transfer]




NOJ_B_8(1DIE)
XYLA_ARTS7
[Raw transfer]




GOL_A_3(4A8R)
XYLA_STRRU
[Raw transfer]




MQD_B_11(1OAD)
XYLA_STRRU
[Raw transfer]




GOL_A_3(4A8N)
XYLA_STRRU
[Raw transfer]




MQD_A_6(1OAD)
XYLA_STRRU
[Raw transfer]




GLT_A_3(1XLI)
XYLA_ARTS7
[Raw transfer]




XYS_A_2(3XIS)
XYLA_STRRU
[Raw transfer]




PGO_A_5(3N4A)
XYLA_STRRU
[Raw transfer]




XUL_A_2(3CWH)
XYLA_STRRU
[Raw transfer]




ARB_A_4(4QDP)
XYLA_STRRU
[Raw transfer]




GLO_A_5(3KCO)
XYLA_STRRU
[Raw transfer]




GLC_B_19(4ZBC)
?
[Raw transfer]




SOR_A_5(4DVO)
XYLA_STRRU
[Raw transfer]




GLC_A_4(3KCL)
XYLA_STRRU
[Raw transfer]




MPD_A_7(4J4K)
XYLA_STRRU
[Raw transfer]




D8U_A_2(3QZA)
XYLA_STRRU
[Raw transfer]




MRD_A_6(3U3H)
XYLA_STRRU
[Raw transfer]




MPD_B_18(1O1H)
XYLA_STRRU
[Raw transfer]




1 PsiBlast_PDB 93.6676% -75 - C3 -1A0D - XYLA_GEOSE -
22 PsiBlast_CBE 93.2976% -76 - C3 -1A0D - XYLA_GEOSE -
21 PsiBlast_CBE 93.2976% -76 - C3 -1A0D - XYLA_GEOSE -
23 PsiBlast_CBE 93.0876% -75 - C3 -1A0D - XYLA_GEOSE -
26 PsiBlast_CBE 90.5269% -71 - C3 -1A0C - XYLA_THETU -
24 PsiBlast_CBE 90.2369% -71 - C3 -1A0C - XYLA_THETU -
2 PsiBlast_PDB 90.0869% -71 - C3 -1A0C - XYLA_THETU -
25 PsiBlast_CBE 90.0369% -71 - C3 -1A0C - XYLA_THETU -
102 HHSearch 88.8969% -67 - C3 -1A0C - XYLA_THETU -
27 PsiBlast_CBE 86.9263% -74 - C3 -1A0E - XYLA_THENE -
121 Fugue 86.9163% -73 - C3 -1A0E - XYLA_THENE -
3 PsiBlast_PDB 86.2163% -74 - C3 -1A0E - XYLA_THENE -
33 PsiBlast_CBE 78.8549% -64 - C3 -4XKM - XYLA_BACTN -
29 PsiBlast_CBE 78.6049% -66 - C3 -4XKM - XYLA_BACTN -
34 PsiBlast_CBE 78.3049% -67 - C3 -4XKM - XYLA_BACTN -
30 PsiBlast_CBE 77.8449% -66 - C3 -4XKM - XYLA_BACTN -
28 PsiBlast_CBE 77.8349% -66 - C3 -4XKM - XYLA_BACTN -
32 PsiBlast_CBE 77.7249% -65 - C3 -4XKM - XYLA_BACTN -
4 PsiBlast_PDB 77.3149% -64 - C3 -4XKM - XYLA_BACTN -
31 PsiBlast_CBE 77.2949% -66 - C3 -4XKM - XYLA_BACTN -
52 PsiBlast_CBE 57.4931% -64 - C3 -4QDP 3.0 XYLA_STRRU
38 PsiBlast_CBE 57.3331% -65 - C3 -1O1H 3.2 XYLA_STRRU
18 PsiBlast_PDB 57.3231% -66 - C3 -3KCO 4.5 XYLA_STRRU
61 PsiBlast_CBE 57.3131% -65 - C3 -3QZA 2.8 XYLA_STRRU
67 PsiBlast_CBE 57.1131% -67 - C3 -3KBN 4.8 XYLA_STRRU
63 PsiBlast_CBE 57.1131% -66 - C3 -3KCL 3.3 XYLA_STRRU
49 PsiBlast_CBE 56.9831% -66 - C3 -4QE4 3.3 XYLA_STRRU
51 PsiBlast_CBE 56.9431% -65 - C3 -4QDW 3.0 XYLA_STRRU
72 PsiBlast_CBE 56.9131% -66 - C3 -1MNZ 3.0 XYLA_STRRU
68 PsiBlast_CBE 56.8031% -67 - C3 -3KBM 3.2 XYLA_STRRU
54 PsiBlast_CBE 56.7631% -66 - C3 -4DVO 4.3 XYLA_STRRU
7 PsiBlast_PDB 56.6331% -64 - C3 -1OAD 3.0 XYLA_STRRU
47 PsiBlast_CBE 56.5331% -64 - C3 -4QEE 4.6 XYLA_STRRU
39 PsiBlast_CBE 56.5131% -64 - C3 -4ZBC 2.0 ?
46 PsiBlast_CBE 56.4331% -65 - C3 -4QEH 3.3 XYLA_STRRU
50 PsiBlast_CBE 56.3931% -67 - C3 -4QE1 3.1 XYLA_STRRU
60 PsiBlast_CBE 56.3731% -64 - C3 -3U3H 3.7 XYLA_STRRU
15 PsiBlast_PDB 56.3031% -63 - C3 -3N4A 4.0 XYLA_STRRU
55 PsiBlast_CBE 56.2831% -63 - C3 -4DUO 3.6 XYLA_STRRU
9 PsiBlast_PDB 56.2031% -64 - C3 -1O1H 3.3 XYLA_STRRU
41 PsiBlast_CBE 56.1831% -63 - C3 -4ZB5 2.9 ?
48 PsiBlast_CBE 56.1631% -66 - C3 -4QE5 3.2 XYLA_STRRU
42 PsiBlast_CBE 56.0431% -65 - C3 -4ZB2 2.8 ?
40 PsiBlast_CBE 55.8431% -63 - C3 -4ZBC 2.5 ?
58 PsiBlast_CBE 55.8131% -63 - C3 -4A8L 3.6 XYLA_STRRU
35 PsiBlast_CBE 55.7831% -60 - C3 -1OAD 3.0 XYLA_STRRU
56 PsiBlast_CBE 55.6731% -64 - C3 -4A8R 2.5 XYLA_STRRU
37 PsiBlast_CBE 55.6031% -65 - C3 -4ZB0 3.0 ?
13 PsiBlast_PDB 55.3931% -67 - C3 -3XIS 4.6 XYLA_STRRU
99 PsiBlast_CBE 55.3632% -87 - C3 -1XLM 3.0 XYLA_ARTS7
57 PsiBlast_CBE 55.3431% -65 - C3 -4A8N 3.6 XYLA_STRRU
100 PsiBlast_CBE 55.2532% -85 - C3 -1XLM 3.3 XYLA_ARTS7
17 PsiBlast_PDB 55.1431% -66 - C3 -4ZB0 3.0 ?
71 PsiBlast_CBE 54.8731% -67 - C3 -2GLK 2.7 XYLA_STRRU
12 PsiBlast_PDB 54.8631% -66 - C3 -2XIS 3.3 XYLA_STRRU
59 PsiBlast_CBE 54.8331% -64 - C3 -4A8I 3.6 XYLA_STRRU
69 PsiBlast_CBE 54.6031% -65 - C3 -3CWH 2.9 XYLA_STRRU
8 PsiBlast_PDB 54.5631% -65 - C3 -4J4K 2.7 XYLA_STRRU
80 PsiBlast_CBE 54.5131% -77 - C3 -1XLI 2.8 XYLA_ARTS7
97 PsiBlast_CBE 53.8631% -76 - C3 -1DID 3.2 XYLA_ARTS7
92 PsiBlast_CBE 53.6631% -74 - C3 -1XLC 3.3 XYLA_ARTS7
14 PsiBlast_PDB 53.6631% -63 - C3 -4XIS 5.3 XYLA_STRRU
89 PsiBlast_CBE 53.5231% -73 - C3 -1XLD 3.0 XYLA_ARTS7
79 PsiBlast_CBE 53.5231% -74 - C3 -1XLI 2.6 XYLA_ARTS7
98 PsiBlast_CBE 53.4231% -73 - C3 -1DID 3.5 XYLA_ARTS7
83 PsiBlast_CBE 53.3831% -75 - C3 -1XLG 3.3 XYLA_ARTS7
78 PsiBlast_CBE 52.9131% -73 - C3 -1XLJ 3.2 XYLA_ARTS7
95 PsiBlast_CBE 52.8931% -72 - C3 -1DIE 3.4 XYLA_ARTS7
77 PsiBlast_CBE 52.8531% -74 - C3 -1XLJ 2.9 XYLA_ARTS7
96 PsiBlast_CBE 52.4631% -75 - C3 -1DIE 3.3 XYLA_ARTS7
90 PsiBlast_CBE 52.4631% -75 - C3 -1XLD 3.1 XYLA_ARTS7
85 PsiBlast_CBE 52.4331% -73 - C3 -1XLF 2.4 XYLA_ARTS7
84 PsiBlast_CBE 52.3831% -78 - C3 -1XLG 3.4 XYLA_ARTS7
91 PsiBlast_CBE 52.1531% -72 - C3 -1XLC 2.4 XYLA_ARTS7
86 PsiBlast_CBE 51.7931% -76 - C3 -1XLF 2.5 XYLA_ARTS7