@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu17620: (2016-06-28 )
MKKILISMIAIVLSITLAACGSNHAAKNHSDSNGTEQVSQDTHSNEYNQTEQKAGTPHSKNQKKLVNVTLDRAIDGDTIKVIYNGKKDTVRYLLVDTPETKKPNSCVQPYGEDASKRNKELVNSGKLQLEFDKGDRRDKYGRLLAYVYVDGKSVQETLLKEGLARVAYVYEPNTKYIDQFRLDEQEAKSDKLSIWSKSGYVTNRGFNGCVK

Atome Classification :

(74 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

THP_A_3(1SNC)
NUC_STAAU
[Raw transfer]




THP_A_2(3NP8)
NUC_STAAU
[Raw transfer]




THP_A_3(3MEH)
NUC_STAAU
[Raw transfer]




THP_A_3(1ENC)
NUC_STAAU
[Raw transfer]




THP_A_2(4LAA)
NUC_STAAU
[Raw transfer]




THP_A_3(4K5W)
NUC_STAAU
[Raw transfer]




THP_A_2(3NK9)
NUC_STAAU
[Raw transfer]




THP_A_2(3OSO)
NUC_STAAU
[Raw transfer]




THP_A_3(4DF7)
NUC_STAAU
[Raw transfer]




THP_A_3(1STG)
NUC_STAAU
[Raw transfer]




THP_A_3(2SNM)
NUC_STAAU
[Raw transfer]




THP_A_2(4ODG)
NUC_STAAU
[Raw transfer]




THP_A_2(4R8N)
NUC_STAAU
[Raw transfer]




THP_A_2(3MXP)
NUC_STAAU
[Raw transfer]




THP_A_2(3NQT)
NUC_STAAU
[Raw transfer]




THP_A_2(3PMF)
NUC_STAAU
[Raw transfer]




THP_A_2(4IZ8)
NUC_STAAU
[Raw transfer]




THP_A_3(1SNM)
NUC_STAAU
[Raw transfer]




THP_A_3(3S9W)
NUC_STAAU
[Raw transfer]




THP_A_3(5C4Z)
NUC_STAAU
[Raw transfer]




THP_A_2(4KTA)
NUC_STAAU
[Raw transfer]




THP_A_3(5C6A)
NUC_STAAU
[Raw transfer]




THP_A_3(3R3O)
NUC_STAAW
[Raw transfer]




THP_A_3(3D6C)
NUC_STAAU
[Raw transfer]




THP_A_3(1SYD)
NUC_STAAU
[Raw transfer]




THP_A_3(4HMJ)
NUC_STAAU
[Raw transfer]




THP_A_3(4F7X)
NUC_STAAU
[Raw transfer]




THP_A_3(4DFA)
NUC_STAAU
[Raw transfer]




THP_A_3(5DEH)
NUC_STAAU
[Raw transfer]




THP_A_2(4ZUJ)
NUC_STAAU
[Raw transfer]




THP_A_3(1SYF)
NUC_STAAU
[Raw transfer]




THP_A_2(4J1M)
NUC_STAAU
[Raw transfer]




THP_A_3(1STA)
NUC_STAAU
[Raw transfer]




THP_A_2(3SR1)
NUC_STAAU
[Raw transfer]




THP_A_3(5EKL)
NUC_STAAU
[Raw transfer]




THP_A_3(3TP8)
NUC_STAAU
[Raw transfer]




THP_A_3(4EQP)
NUC_STAAU
[Raw transfer]




THP_A_3(4ZQ3)
NUC_STAAU
[Raw transfer]




THP_A_2(3ITP)
NUC_STAAU
[Raw transfer]




THP_A_3(4F8M)
NUC_STAAU
[Raw transfer]




THP_A_3(3BDC)
NUC_STAAU
[Raw transfer]




THP_A_3(5IIF)
?
[Raw transfer]




THP_A_3(4QF4)
NUC_STAAU
[Raw transfer]




THP_B_6(4QF4)
NUC_STAAU
[Raw transfer]




THP_A_3(3RUZ)
NUC_STAAU
[Raw transfer]




THP_A_3(4KD4)
NUC_STAAU
[Raw transfer]




THP_C_11(3HEJ)
NUC_STAAU
[Raw transfer]




THP_A_2(3NXW)
NUC_STAAU
[Raw transfer]




THP_D_8(3HEJ)
NUC_STAAU
[Raw transfer]




THP_A_3(1STH)
NUC_STAAU
[Raw transfer]




THP_A_3(1STB)
NUC_STAAU
[Raw transfer]




THP_A_3(1SYB)
NUC_STAAU
[Raw transfer]




THP_A_2(4J6H)
NUC_STAAU
[Raw transfer]




THP_A_2(4K5X)
NUC_STAAU
[Raw transfer]




THP_A_3(1STY)
NUC_STAAU
[Raw transfer]




THP_A_3(5I9P)
?
[Raw transfer]




THP_A_2(4K6D)
NUC_STAAU
[Raw transfer]




THP_A_3(4WOR)
NUC_STAAU
[Raw transfer]




THP_B_9(3HEJ)
NUC_STAAU
[Raw transfer]




THP_A_3(2SNS)
NUC_STAAU
[Raw transfer]




THP_A_2(3MVV)
NUC_STAAW
[Raw transfer]




THP_A_2(2ENB)
NUC_STAAU
[Raw transfer]




THP_A_2(3LX0)
NUC_STAAU
[Raw transfer]




THP_B_2(2OXP)
NUC_STAAW
[Raw transfer]




THP_A_2(1JOK)
NUC_STAAU
[Raw transfer]




THP_A_5(3HEJ)
NUC_STAAU
[Raw transfer]




MRD_A_7(3T13)
NUC_STAAU
[Raw transfer]




MRD_B_10(3T13)
NUC_STAAU
[Raw transfer]




THP_A_2(1JOQ)
NUC_STAAU
[Raw transfer]




MPD_A_3(3DMU)
NUC_STAAU
[Raw transfer]




THP_A_3(1A2T)
NUC_STAAU
[Raw transfer]




MPD_A_6(3HEJ)
NUC_STAAU
[Raw transfer]




37 PsiBlast_CBE 86.4355% -79 - C6 -4K5W 6.5 NUC_STAAU
4 PsiBlast_PDB 85.8255% -72 - C6 -4K5X 6.8 NUC_STAAU
21 PsiBlast_CBE 85.6355% -78 - C6 -4KD4 6.9 NUC_STAAU
11 PsiBlast_PDB 85.0756% -77 - C6 -4R8N 6.5 NUC_STAAU
27 PsiBlast_CBE 84.8855% -70 - C6 -4QF4 6.2 NUC_STAAU
28 PsiBlast_CBE 84.7955% -71 - C6 -4QF4 6.3 NUC_STAAU
30 PsiBlast_CBE 84.7655% -80 - C6 -1JOK 5.0 NUC_STAAU
40 PsiBlast_CBE 84.7554% -77 - C6 -1SYF 6.4 NUC_STAAU
31 PsiBlast_CBE 84.6855% -97 - C6 -4K6D 7.1 NUC_STAAU
18 PsiBlast_PDB 84.6056% -66 - C6 -4G57 - NUC_STAAU -
23 PsiBlast_CBE 84.5955% -78 - C6 -1STH 6.9 NUC_STAAU
43 PsiBlast_CBE 84.4254% -71 - C6 -1STY 7.0 NUC_STAAU
22 PsiBlast_CBE 84.3255% -76 - C6 -4WOR 6.6 NUC_STAAU
19 PsiBlast_PDB 84.3054% -77 - C6 -4ODG 6.9 NUC_STAAU
9 PsiBlast_PDB 84.2356% -66 - C6 -2F0I - NUC_STAAU -
41 PsiBlast_CBE 84.0654% -76 - C6 -1SYD 6.9 NUC_STAAU
7 PsiBlast_PDB 84.0456% -68 - C6 -2F0W - NUC_STAAU -
24 PsiBlast_CBE 84.0255% -74 - C6 -1STG 6.8 NUC_STAAU
36 PsiBlast_CBE 83.9854% -79 - C6 -1SNM 6.6 NUC_STAAU
32 PsiBlast_CBE 83.9854% -74 - C6 -1ENC 6.5 NUC_STAAU
60 PsiBlast_CBE 83.9351% -80 - C6 -5EKL 6.7 NUC_STAAU
26 PsiBlast_CBE 83.8655% -73 - C6 -1STA 7.0 NUC_STAAU
25 PsiBlast_CBE 83.8155% -76 - C6 -1SNC 6.7 NUC_STAAU
44 PsiBlast_CBE 83.7154% -71 - C6 -1SYB 6.7 NUC_STAAU
46 PsiBlast_CBE 83.6355% -76 - C6 -1A2T 2.3 NUC_STAAU
42 PsiBlast_CBE 83.5654% -51 - C6 -1STB 6.5 NUC_STAAU
87 PsiBlast_CBE 83.4551% -83 - C6 -3NXW 7.0 NUC_STAAU
34 PsiBlast_CBE 83.3754% -78 - C6 -2ENB 6.1 NUC_STAAU
75 PsiBlast_CBE 83.3351% -95 - C6 -3MXP 6.9 NUC_STAAU
69 PsiBlast_CBE 83.3051% -91 - C6 -3BDC 7.1 NUC_STAAU
67 PsiBlast_CBE 82.9251% -85 - C6 -3S9W 7.0 NUC_STAAU
59 PsiBlast_CBE 82.8052% -89 - C6 -4F8M 6.9 NUC_STAAU
82 PsiBlast_CBE 82.7051% -89 - C6 -5DEH 6.8 NUC_STAAU
85 PsiBlast_CBE 82.6651% -84 - C6 -3NK9 6.9 NUC_STAAU
73 PsiBlast_CBE 82.5551% -89 - C6 -3OSO 6.8 NUC_STAAU
71 PsiBlast_CBE 82.5551% -87 - C6 -4KTA 7.1 NUC_STAAU
100 PsiBlast_CBE 82.4151% -82 - C6 -3RUZ 6.8 NUC_STAAU
95 PsiBlast_CBE 82.3751% -80 - C6 -3PMF 6.8 NUC_STAAU
86 PsiBlast_CBE 82.3150% -88 - C6 -4DF7 6.9 NUC_STAAU
80 PsiBlast_CBE 82.3051% -87 - C6 -4J1M 6.8 NUC_STAAU
61 PsiBlast_CBE 82.2751% -93 - C6 -5I9P 6.9 ?
91 PsiBlast_CBE 82.2551% -76 - C6 -4DFA 6.8 NUC_STAAU
68 PsiBlast_CBE 82.1851% -85 - C6 -5IIF 7.1 ?
50 PsiBlast_CBE 82.1653% -60 - C6 -3D6C 6.6 NUC_STAAU
72 PsiBlast_CBE 82.1551% -82 - C6 -4IZ8 6.9 NUC_STAAU
39 PsiBlast_CBE 82.0254% -60 - C6 -2SNM 6.1 NUC_STAAU
58 PsiBlast_CBE 82.0051% -83 - C6 -4LAA 6.9 NUC_STAAU
64 PsiBlast_CBE 81.9851% -75 - C6 -3T13 3.3 NUC_STAAU
90 PsiBlast_CBE 81.9451% -84 - C6 -4ZQ3 6.9 NUC_STAAU
74 PsiBlast_CBE 81.8751% -85 - C6 -3R3O 6.8 NUC_STAAW
84 PsiBlast_CBE 81.7851% -75 - C6 -5C6A 7.0 NUC_STAAU
94 PsiBlast_CBE 81.7751% -83 - C6 -4J6H 6.8 NUC_STAAU
65 PsiBlast_CBE 81.6051% -83 - C6 -3SR1 6.9 NUC_STAAU
51 PsiBlast_CBE 81.5853% -62 - C6 -2OXP 6.8 NUC_STAAW
99 PsiBlast_CBE 81.4751% -78 - C6 -5C4Z 6.8 NUC_STAAU
63 PsiBlast_CBE 81.3551% -77 - C6 -3T13 2.6 NUC_STAAU
92 PsiBlast_CBE 81.2951% -80 - C6 -4F7X 6.7 NUC_STAAU
98 PsiBlast_CBE 81.2250% -84 - C6 -3LX0 6.8 NUC_STAAU
97 PsiBlast_CBE 81.1650% -84 - C6 -4ZUJ 7.0 NUC_STAAU
93 PsiBlast_CBE 81.1151% -75 - C6 -4HMJ 7.0 NUC_STAAU
70 PsiBlast_CBE 81.1151% -82 - C6 -3NP8 6.8 NUC_STAAU
89 PsiBlast_CBE 81.0751% -75 - C6 -3ITP 7.0 NUC_STAAU
96 PsiBlast_CBE 80.9950% -83 - C6 -3NQT 6.8 NUC_STAAU
88 PsiBlast_CBE 80.8651% -92 - C6 -3MEH 7.2 NUC_STAAU
83 PsiBlast_CBE 80.8051% -75 - C6 -3TP8 6.9 NUC_STAAU
45 PsiBlast_CBE 80.5454% -77 - C6 -3DMU 3.6 NUC_STAAU
62 PsiBlast_CBE 80.5251% -86 - C6 -3MVV 6.7 NUC_STAAW
29 PsiBlast_CBE 80.2555% -62 - C6 -1JOQ 4.7 NUC_STAAU
111 HHSearch 79.5249% -63 * C6 *4EQP 6.9 NUC_STAAU
33 PsiBlast_CBE 78.8553% -66 - C6 -2SNS 5.2 NUC_STAAU
78 PsiBlast_CBE 78.3151% -67 - C6 -3HEJ 6.6 NUC_STAAU
79 PsiBlast_CBE 77.9751% -65 - C6 -3HEJ 6.2 NUC_STAAU
76 PsiBlast_CBE 77.5751% -59 - C6 -3HEJ 6.7 NUC_STAAU
77 PsiBlast_CBE 76.7151% -57 - C6 -3HEJ 6.2 NUC_STAAU