@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu17680: (2016-06-28 )
MTQFDKQYNSIIKDIINNGISDEEFDVRTKWDSDGTPAHTLSVISKQMRFDNSEVPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNMMGVHIWDQWKQEDGTIGHAYGFQLGKKNRSLNGEKVDQVDYLLHQLKNNPSSRRHITMLWNPDELDAMALTPCVYETQWYVKHGKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEVKDFYDFTIDDFKLINYKHGDKLLFEVAV

Atome Classification :

(58 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UMP_A_6(3NRR)
?
[Raw transfer]




UMP_A_3(4DQ1)
TYSY_STAAM
[Raw transfer]




UMP_E_5(1F28)
TYSY_PNECA
[Raw transfer]




UMP_B_11(5BY6)
?
[Raw transfer]




UMP_A_5(3QG2)
?
[Raw transfer]




NOH_B_4(4EIN)
TYSY_MOUSE
[Raw transfer]




C2F_A_3(1B02)
TYSY1_BACSU
[Raw transfer]




BVP_A_5(4XSC)
TYSY_VZVO
[Raw transfer]




UMP_C_7(1J3K)
?
[Raw transfer]




UMP_A_5(5BY6)
?
[Raw transfer]




UMP_D_14(5BY6)
?
[Raw transfer]




DHF_A_3(4EZ8)
TYSY_MOUSE
[Raw transfer]




UMP_C_12(5BY6)
?
[Raw transfer]




LYA_H_8(1JUJ)
TYSY_HUMAN
[Raw transfer]




DHF_A_3(4EZ8)
TYSY_MOUSE
[Raw transfer]




LYA_L_12(1JUJ)
TYSY_HUMAN
[Raw transfer]




LYA_J_10(1JUJ)
TYSY_HUMAN
[Raw transfer]




LYA_F_6(1JUJ)
TYSY_HUMAN
[Raw transfer]




LYA_G_7(1JU6)
TYSY_HUMAN
[Raw transfer]




LYA_K_11(1JU6)
TYSY_HUMAN
[Raw transfer]




LYA_M_13(1JU6)
TYSY_HUMAN
[Raw transfer]




D16_A_6(4EB4)
TYSY_MOUSE
[Raw transfer]




LYA_I_9(1JU6)
TYSY_HUMAN
[Raw transfer]




D16_H_8(1HVY)
TYSY_HUMAN
[Raw transfer]




D16_B_6(1I00)
TYSY_HUMAN
[Raw transfer]




D16_G_7(1HVY)
TYSY_HUMAN
[Raw transfer]




D16_F_6(1HVY)
TYSY_HUMAN
[Raw transfer]




GOL_B_5(4EIN)
TYSY_MOUSE
[Raw transfer]




D16_J_10(2TSR)
TYSY_RAT
[Raw transfer]




D16_A_5(1I00)
TYSY_HUMAN
[Raw transfer]




D16_F_6(1RTS)
TYSY_RAT
[Raw transfer]




LYA_A_4(4FQS)
TYSY_MYCTU
[Raw transfer]




GOL_D_17(5BY6)
?
[Raw transfer]




D16_E_5(1HVY)
TYSY_HUMAN
[Raw transfer]




D16_I_9(2TSR)
TYSY_RAT
[Raw transfer]




D16_K_11(2TSR)
TYSY_RAT
[Raw transfer]




CIT_A_5(3V8H)
?
[Raw transfer]




D16_E_5(1RTS)
TYSY_RAT
[Raw transfer]




D16_L_12(2TSR)
TYSY_RAT
[Raw transfer]




DTT_A_6(5BY6)
?
[Raw transfer]




1PE_A_6(4XSC)
TYSY_VZVO
[Raw transfer]




UFP_D_8(3EJL)
TYSY_HUMAN
[Raw transfer]




BME_A_5(2RD8)
TYSY_HUMAN
[Raw transfer]




EDO_B_24(3NRR)
?
[Raw transfer]




2 PsiBlast_PDB 99.04100% -90 - C8 -1BKO - TYSY1_BACSU -
3 PsiBlast_PDB 98.94100% -93 - C- -1BKP - TYSY1_BACSU -
21 PsiBlast_CBE 98.43100% -90 - C8 -1BSP - TYSY1_BACSU -
1 PsiBlast_PDB 97.41100% -87 - C8 -1B02 5.6 TYSY1_BACSU
5 PsiBlast_PDB 96.72100% -90 - C8 -1BSP - TYSY1_BACSU -
4 PsiBlast_PDB 96.03100% -89 - C8 -1BSF - TYSY1_BACSU -
101 HHSearch 77.8597% 11 - C- -1BKP - TYSY1_BACSU -
122 Fugue 75.84100% -1 - C- -1BKP - TYSY1_BACSU -
6 PsiBlast_PDB 66.6338% -48 - C8 -3IX6 - TYSY_BRUME -
51 PsiBlast_CBE 66.3236% 3 - C8 -3OB7 - TYSY_HUMAN -
88 PsiBlast_CBE 66.1836% 3 - C8 -4H1I - TYSY_HUMAN -
50 PsiBlast_CBE 66.1736% 5 - C8 -3OB7 - TYSY_HUMAN -
87 PsiBlast_CBE 66.0236% 6 - C8 -4H1I - TYSY_HUMAN -
54 PsiBlast_CBE 65.9836% 5 - C8 -3HB8 - TYSY_HUMAN -
55 PsiBlast_CBE 65.9336% 4 - C8 -3HB8 - TYSY_HUMAN -
56 PsiBlast_CBE 65.8836% 2 - C8 -3HB8 - TYSY_HUMAN -
59 PsiBlast_CBE 65.7736% 4 - C8 -3H9K - TYSY_HUMAN -
83 PsiBlast_CBE 65.7536% 2 - C8 -5HS3 - ? -
65 PsiBlast_CBE 65.6036% 5 - C8 -2RDA - TYSY_HUMAN -
79 PsiBlast_CBE 65.5636% 3 - C8 -5HS3 - ? -
69 PsiBlast_CBE 65.4536% 2 - C8 -1I00 4.4 TYSY_HUMAN
42 PsiBlast_CBE 65.3636% 2 - C8 -1JU6 5.8 TYSY_HUMAN
41 PsiBlast_CBE 65.1836% 4 - C8 -1JU6 6.1 TYSY_HUMAN
20 PsiBlast_PDB 65.0836% 3 - C8 -2RD8 1.9 TYSY_HUMAN
35 PsiBlast_CBE 64.9736% 1 - C8 -3EJL 3.9 TYSY_HUMAN
43 PsiBlast_CBE 64.9636% 3 - C8 -1JU6 6.4 TYSY_HUMAN
12 PsiBlast_PDB 64.6036% 4 - C8 -1JU6 6.4 TYSY_HUMAN
38 PsiBlast_CBE 64.2736% 7 - C8 -1JUJ 6.1 TYSY_HUMAN
39 PsiBlast_CBE 64.1236% 7 - C8 -1JUJ 6.3 TYSY_HUMAN
40 PsiBlast_CBE 64.1136% 7 - C8 -1JUJ 6.0 TYSY_HUMAN
68 PsiBlast_CBE 64.0136% 9 - C8 -1I00 4.7 TYSY_HUMAN
9 PsiBlast_PDB 63.9735% 3 - C8 -4EB4 6.0 TYSY_MOUSE
13 PsiBlast_PDB 63.8736% 7 - C8 -1JUJ 6.1 TYSY_HUMAN
95 PsiBlast_CBE 63.7336% 15 - C8 -5BY6 4.5 ?
108 HHSearch 63.5036% 2 - C8 -1F28 3.6 TYSY_PNECA
115 HHSearch 63.3931% -7 - C8 -3V8H 3.2 ?
77 PsiBlast_CBE 63.3735% 7 - C8 -1RTS 4.8 TYSY_RAT
121 HHSearch 63.2436% -20 - C8 -3NRR 4.7 ?
22 PsiBlast_CBE 63.1835% 7 - C8 -4EIN 3.9 TYSY_MOUSE
10 PsiBlast_PDB 63.0835% 5 - C8 -4EZ8 5.9 TYSY_MOUSE
75 PsiBlast_CBE 63.0235% 8 - C8 -2TSR 5.0 TYSY_RAT
74 PsiBlast_CBE 62.8835% 8 - C8 -2TSR 4.7 TYSY_RAT
96 PsiBlast_CBE 62.6636% 22 - C8 -5BY6 4.6 ?
76 PsiBlast_CBE 62.5435% 9 - C8 -2TSR 4.6 TYSY_RAT
110 HHSearch 62.5039% -11 - C8 -1J3K 4.6 ?
78 PsiBlast_CBE 62.4235% 6 - C8 -1RTS 4.8 TYSY_RAT
93 PsiBlast_CBE 62.3638% 7 - C8 -1HVY 5.2 TYSY_HUMAN
97 PsiBlast_CBE 62.3336% 22 - C8 -5BY6 4.5 ?
112 HHSearch 62.1335% -27 - C8 -4FQS 5.8 TYSY_MYCTU
91 PsiBlast_CBE 62.1238% 9 - C8 -1HVY 5.6 TYSY_HUMAN
94 PsiBlast_CBE 62.0636% 19 - C8 -5BY6 4.5 ?
116 HHSearch 61.8738% -12 * C8 *4XSC 4.7 TYSY_VZVO
119 HHSearch 61.7739% -10 - C8 -3QG2 4.7 ?
73 PsiBlast_CBE 61.7335% 6 - C8 -2TSR 3.7 TYSY_RAT
92 PsiBlast_CBE 61.5438% 6 - C8 -1HVY 5.9 TYSY_HUMAN
103 HHSearch 61.3538% 2 - C8 -4EZ8 5.9 TYSY_MOUSE
90 PsiBlast_CBE 60.5238% 11 - C8 -1HVY 6.2 TYSY_HUMAN
104 HHSearch 58.1838% 9 - C8 -4DQ1 4.1 TYSY_STAAM