Study : bsu17840 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C1_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C1_S1
Complex: FCN_A_4(4JH4) / Model_9(4JH4/A) = [3.1] Download297.8410.50MEIKGINHLLFSVSHLDTSIDFYQKVFGAKLLVKGRTTAYFDMNGIWLALNEEPDIPRNDIKLSYTHIAFTIEDHEFEEMSAKLKRLHVNILPGRERDERDRKSIYFTDPDGHKFEFHTGTLQDRLRYYKQEKTHMHFYDETAF
Complex: FCN_A_4(4JH5) / Model_8(4JH5/A) = [3.1] Download484.0810.50MEIKGINHLLFSVSHLDTSIDFYQKVFGAKLLVKGRTTAYFDMNGIWLALNEEPDIPRNDIKLSYTHIAFTIEDHEFEEMSAKLKRLHVNILPGRERDERDRKSIYFTDPDGHKFEFHTGTLQDRLRYYKQEKTHMHFYDETAF
Complex: FCN_A_6(4JH8) / Model_5(4JH8/A) = [3.1] Download572.1210.27MEIKGINHLLFSVSHLDTSIDFYQKVFGAKLLVKGRTTAYFDMNGIWLALNEEPDIPRNDIKLSYTHIAFTIEDHEFEEMSAKLKRLHVNILPGRERDERDRKSIYFTDPDGHKFEFHTGTLQDRLRYYKQEKTHMHFYDETAF
Complex: FCN_B_11(4JH3) / Model_29(4JH3/B) = [3.1] Download499.5010.50MEIKGINHLLFSVSHLDTSIDFYQKVFGAKLLVKGRTTAYFDMNGIWLALNEEPDIPRNDIKLSYTHIAFTIEDHEFEEMSAKLKRLHVNILPGRERDERDRKSIYFTDPDGHKFEFHTGTLQDRLRYYKQEKTHMHFYDETAF
Complex: CYS_B_12(4JH8) / Model_24(4JH8/B) = [3.1] Download596.62-2.50MEIKGINHLLFSVSHLDTSIDFYQKVFGAKLLVKGRTTAYFDMNGIWLALNEEPDIPRNDIKLSYTHIAFTIEDHEFEEMSAKLKRLHVNILPGRERDERDRKSIYFTDPDGHKFEFHTGTLQDRLRYYKQEKTHMHFYDETAF
Consensus
[pKd Mean = 3.10]
-490
(s=105)
7
(s=5)
MEIKGINHLLFSVSHLDTSIDFYQKVFGAKLLVKGRTTAYFDMNGIWLALNEEPDIPRNDIKLSYTHIAFTIEDHEFEEMSAKLKRLHVNILPGRERDERDRKSIYFTDPDGHKFEFHTGTLQDRLRYYKQEKTHMHFYDETAF