@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu17840: (2016-06-28 )
MEIKGINHLLFSVSHLDTSIDFYQKVFGAKLLVKGRTTAYFDMNGIWLALNEEPDIPRNDIKLSYTHIAFTIEDHEFEEMSAKLKRLHVNILPGRERDERDRKSIYFTDPDGHKFEFHTGTLQDRLRYYKQEKTHMHFYDETAF

Atome Classification :

(39 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

1KM_A_6(4JH7)
FOSB_BACC1
[Raw transfer]




1KM_A_4(4JH9)
FOSB_BACC1
[Raw transfer]




1KM_B_6(4JH9)
FOSB_BACC1
[Raw transfer]




1KM_B_9(4JH7)
FOSB_BACC1
[Raw transfer]




FCN_B_6(4JH4)
FOSB_BACC1
[Raw transfer]




FCN_B_8(4JH5)
FOSB_BACC1
[Raw transfer]




FCN_B_11(4JH8)
FOSB_BACC1
[Raw transfer]




FCN_A_4(4JH5)
FOSB_BACC1
[Raw transfer]




FCN_A_4(4JH4)
FOSB_BACC1
[Raw transfer]




FCN_A_4(4IR0)
FOSB2_BACAN
[Raw transfer]




FCN_A_6(4JH8)
FOSB_BACC1
[Raw transfer]




FCN_A_6(4JH3)
FOSB_BACC1
[Raw transfer]




FCN_B_9(4JH6)
FOSB_BACC1
[Raw transfer]




FCN_A_4(4JH6)
FOSB_BACC1
[Raw transfer]




FCN_B_11(4JH3)
FOSB_BACC1
[Raw transfer]




FCN_B_7(4JD1)
FOSB2_BACAN
[Raw transfer]




PPF_A_7(1NKI)
FOSA_PSEAE
[Raw transfer]




PPF_B_8(1NKI)
FOSA_PSEAE
[Raw transfer]




PPF_A_7(1NKI)
FOSA_PSEAE
[Raw transfer]




FMT_B_11(4JH2)
FOSB_BACC1
[Raw transfer]




GG6_D_15(2P7Q)
?
[Raw transfer]




FCN_A_8(1LQP)
FOSA_PSEAE
[Raw transfer]




CIT_C_3(2P7K)
FOSX_LISMO
[Raw transfer]




GOL_B_7(2P7L)
FOSX_LISMO
[Raw transfer]




GG6_A_14(2P7Q)
?
[Raw transfer]




GG6_E_18(2P7Q)
?
[Raw transfer]




GG6_F_17(2P7Q)
?
[Raw transfer]




GG6_B_13(2P7Q)
?
[Raw transfer]




GG6_C_16(2P7Q)
?
[Raw transfer]




CIT_D_4(2P7K)
FOSX_LISMO
[Raw transfer]




CYS_B_4(4NB0)
FOSB_STAAN
[Raw transfer]




FCN_B_9(1LQP)
FOSA_PSEAE
[Raw transfer]




CYS_B_5(4NB1)
FOSB_STAAN
[Raw transfer]




CYS_B_3(4NB1)
FOSB_STAAN
[Raw transfer]




CYS_B_12(4JH8)
FOSB_BACC1
[Raw transfer]




CYS_A_7(4JH8)
FOSB_BACC1
[Raw transfer]




2 PsiBlast_PDB 96.2866%-113 - C1 -5F6Q - FOSB2_BACAN -
1 PsiBlast_PDB 95.3966%-121 - C1 -4JD1 - FOSB2_BACAN -
8 PsiBlast_PDB 95.0462%-127 - C1 -4JH5 3.1 FOSB_BACC1
12 PsiBlast_PDB 94.8562%-130 - C1 -4JH1 - FOSB_BACC1 -
10 PsiBlast_PDB 94.7362%-119 - C1 -4JH3 3.2 FOSB_BACC1
22 PsiBlast_CBE 94.6366%-108 - C1 -5F6Q - FOSB2_BACAN -
7 PsiBlast_PDB 94.2662%-129 - C1 -4JH6 3.1 FOSB_BACC1
29 PsiBlast_CBE 94.1962%-130 - C1 -4JH3 3.1 FOSB_BACC1
5 PsiBlast_PDB 94.1862%-122 - C1 -4JH8 3.1 FOSB_BACC1
21 PsiBlast_CBE 94.0466%-107 - C1 -4JD1 3.0 FOSB2_BACAN
28 PsiBlast_CBE 93.8562%-124 - C1 -4JH4 2.8 FOSB_BACC1
24 PsiBlast_CBE 93.8462%-116 - C1 -4JH8 3.1 FOSB_BACC1
6 PsiBlast_PDB 93.8262%-126 - C1 -4JH7 3.3 FOSB_BACC1
27 PsiBlast_CBE 93.7762%-113 - C1 -4JH5 2.8 FOSB_BACC1
3 PsiBlast_PDB 93.6065%-117 - C1 -4IR0 2.9 FOSB2_BACAN
11 PsiBlast_PDB 93.3862%-127 - C1 -4JH2 - FOSB_BACC1 -
26 PsiBlast_CBE 93.1562%-120 - C1 -4JH6 3.3 FOSB_BACC1
25 PsiBlast_CBE 93.0662%-119 - C1 -4JH7 3.4 FOSB_BACC1
23 PsiBlast_CBE 93.0562%-123 - C1 -4JH9 3.2 FOSB_BACC1
4 PsiBlast_PDB 92.6062%-127 - C1 -4JH9 3.0 FOSB_BACC1
9 PsiBlast_PDB 92.5062%-124 - C1 -4JH4 3.1 FOSB_BACC1
30 PsiBlast_CBE 91.8862%-115 - C1 -4JH2 3.2 FOSB_BACC1
33 PsiBlast_CBE 86.9062%-133 - C1 -4NB1 3.6 FOSB_STAAN
34 PsiBlast_CBE 84.7562%-126 - C1 -4NB0 3.4 FOSB_STAAN
13 PsiBlast_PDB 83.4662%-149 - C1 -4NB1 3.5 FOSB_STAAN
55 PsiBlast_CBE 75.5836% -81 - C1 -1NKI 3.4 FOSA_PSEAE
56 PsiBlast_CBE 73.1536% -81 - C1 -1NKI 3.5 FOSA_PSEAE
51 PsiBlast_CBE 72.5533% -1 - C1 -2P7Q 3.7 ?
57 PsiBlast_CBE 72.4136% -85 - C1 -1LQP 2.7 FOSA_PSEAE
58 PsiBlast_CBE 71.5636% -87 - C1 -1LQP 2.9 FOSA_PSEAE
50 PsiBlast_CBE 71.0033% 2 - C1 -2P7Q 4.2 ?
109 HHSearch 70.7835%-123 * C1 *1NKI 3.7 FOSA_PSEAE
49 PsiBlast_CBE 70.4833% 9 - C1 -2P7Q 4.1 ?
48 PsiBlast_CBE 70.2533% 7 - C1 -2P7Q 4.3 ?
46 PsiBlast_CBE 69.0633% -7 - C1 -2P7L 2.9 FOSX_LISMO
15 PsiBlast_PDB 68.7733% 24 - C1 -2P7K 2.8 FOSX_LISMO
47 PsiBlast_CBE 68.5733% 24 - C1 -2P7K 3.2 FOSX_LISMO
20 PsiBlast_PDB 68.1433% 11 - C1 -2P7Q 2.8 ?
52 PsiBlast_CBE 67.2833% 1 - C1 -2P7Q 4.1 ?