@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu18010: (2016-06-28 )
MLKKWLAGILLIMLVGYTGWNLYQTYSKKEVGIQEGQQAPDFSLKTLSGEKSSLQDAKGKKVLLNFWATWCKPCRQEMPAMEKLQKEYADKLAVVAVNFTSAEKSEKQVRAFADTYDLTFPILIDKKGINADYNVMSYPTTYILDEKGVIQDIHVGTMTKKEMEQKLDLD

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ACY_A_5(4NMU)
RESA_BACAN
[Raw transfer]




136 HHSearch 80.8338% -24 - C1 -4NMU - RESA_BACAN -
1 PsiBlast_PDB 79.5138% -27 * C1 *4NMU 3.1 RESA_BACAN
24 PsiBlast_CBE 78.2534% -33 - C1 -2H1B - RESA_BACSU -
17 PsiBlast_PDB 77.7834% -30 - C1 -4HQS - ? -
6 PsiBlast_PDB 77.5634% -32 - C1 -2H1B - RESA_BACSU -
2 PsiBlast_PDB 76.8434% -26 - C1 -1ST9 - RESA_BACSU -
8 PsiBlast_PDB 76.5534% -35 - C1 -2H1A - RESA_BACSU -
25 PsiBlast_CBE 76.5234% -38 - C1 -2H1A - RESA_BACSU -
21 PsiBlast_CBE 76.3834% -33 - C1 -1ST9 - RESA_BACSU -
11 PsiBlast_PDB 76.2833% -40 - C1 -3C73 - RESA_BACSU -
9 PsiBlast_PDB 76.2234% -30 - C1 -3C71 - RESA_BACSU -
22 PsiBlast_CBE 76.1434% -35 - C1 -2H1B - RESA_BACSU -
18 PsiBlast_PDB 76.0034% -33 - C- -4EVM - ? -
12 PsiBlast_PDB 75.9938%-100 - C1 -3KCM - ? -
26 PsiBlast_CBE 75.8534% -30 - C1 -2H19 - RESA_BACSU -
23 PsiBlast_CBE 75.8134% -28 - C1 -2H1B - RESA_BACSU -
7 PsiBlast_PDB 75.5534% -31 - C1 -2H19 - RESA_BACSU -
3 PsiBlast_PDB 75.4834% -32 - C1 -1SU9 - RESA_BACSU -
10 PsiBlast_PDB 75.3833% -24 - C1 -2H1G - RESA_BACSU -
4 PsiBlast_PDB 75.3034% -26 - C1 -2H1D - RESA_BACSU -