@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu18180: (2016-06-29 )
MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAESGIEDILIITGRNKRSIEDHFDRSAELEFNLREKGKTETLKEMQQIADLANIHYIRQKEPLGLGHAVLCAEHFIGDEPFAVLLGDDIMVSETPALRQLMDVYDVYGTEVVGVQSVLPEDVSKYGIINTSGSQGHVYEVNDLVEKPSPEEAPSEIAVMGRYVLNSSIFSVLKTIGRGAGNEIQLTDALREVCRKEPIHARLLEGNRYDIGDKLGCFKASTEIGLMRPEMRSQLLAYLEDVIKRETKEMLR

Atome Classification :

(43 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GUD_C_15(2PA4)
?
[Raw transfer]




GUD_A_13(2PA4)
?
[Raw transfer]




UPG_C_13(3JUK)
?
[Raw transfer]




GUD_D_16(2PA4)
?
[Raw transfer]




GUD_A_13(2PA4)
?
[Raw transfer]




UPG_A_5(3JUK)
?
[Raw transfer]




GUD_B_14(2PA4)
?
[Raw transfer]




UPG_H_8(1MP5)
RMLA_SALTY
[Raw transfer]




UPG_A_5(3JUK)
?
[Raw transfer]




UPG_A_2(5I1F)
?
[Raw transfer]




UPG_B_9(3JUK)
?
[Raw transfer]




UPG_D_17(3JUK)
?
[Raw transfer]




UPG_A_2(5I1F)
?
[Raw transfer]




UPG_E_5(1IIN)
RMLA_SALTY
[Raw transfer]




UPG_H_8(1IIN)
RMLA_SALTY
[Raw transfer]




DAU_B_9(1H5T)
RMLA1_ECOLI
[Raw transfer]




DAU_C_11(1H5T)
RMLA1_ECOLI
[Raw transfer]




UPG_E_5(1MP5)
RMLA_SALTY
[Raw transfer]




UPG_F_6(1IIN)
RMLA_SALTY
[Raw transfer]




UPG_F_6(1MP4)
RMLA_SALTY
[Raw transfer]




DAU_A_7(1H5T)
RMLA1_ECOLI
[Raw transfer]




UPG_E_5(1MP4)
RMLA_SALTY
[Raw transfer]




DAU_D_13(1H5T)
RMLA1_ECOLI
[Raw transfer]




UPG_F_6(1MP5)
RMLA_SALTY
[Raw transfer]




TTP_A_5(1MC3)
RMLA2_ECOLI
[Raw transfer]




UPG_G_7(1MP5)
RMLA_SALTY
[Raw transfer]




UPG_G_7(1IIN)
RMLA_SALTY
[Raw transfer]




TTP_I_9(1MP3)
RMLA_SALTY
[Raw transfer]




TMP_C_10(1H5S)
RMLA1_ECOLI
[Raw transfer]




TMP_A_6(1H5S)
RMLA1_ECOLI
[Raw transfer]




TMP_D_12(1H5S)
RMLA1_ECOLI
[Raw transfer]




G1P_A_5(1H5R)
RMLA1_ECOLI
[Raw transfer]




THM_A_5(5IDT)
?
[Raw transfer]




GOL_A_3(3PNN)
?
[Raw transfer]




TMP_B_8(1H5S)
RMLA1_ECOLI
[Raw transfer]




G1P_D_8(1H5R)
RMLA1_ECOLI
[Raw transfer]




G1P_C_7(1H5R)
RMLA1_ECOLI
[Raw transfer]




G1P_B_6(1H5R)
RMLA1_ECOLI
[Raw transfer]




POP_A_2(4G3Q)
GLMU_MYCTU
[Raw transfer]




22 PsiBlast_CBE 91.5047%-104 - C1 -2UX8 - ? -
23 PsiBlast_CBE 90.2747%-109 - C1 -2UX8 - ? -
26 PsiBlast_CBE 89.4847%-108 - C1 -2UX8 - ? -
25 PsiBlast_CBE 89.3347%-111 - C1 -2UX8 - ? -
1 PsiBlast_PDB 89.1250% -42 - C1 -5I1F 6.5 ?
24 PsiBlast_CBE 88.3547%-111 - C1 -2UX8 - ? -
77 HHSearch 87.2650% -38 - C1 -5I1F 6.5 ?
27 PsiBlast_CBE 85.8147%-108 - C1 -2UX8 - ? -
21 PsiBlast_CBE 83.6147%-132 - C1 -2UX8 - ? -
78 HHSearch 82.1348% -34 - C1 -3JUK 7.7 ?
3 PsiBlast_PDB 81.0549% -32 - C1 -3JUK 7.7 ?
2 PsiBlast_PDB 81.0149% -29 - C1 -3JUJ - ? -
30 PsiBlast_CBE 80.1249% -26 - C1 -3JUK 7.5 ?
32 PsiBlast_CBE 80.1142% -43 - C1 -2PA4 6.3 ?
29 PsiBlast_CBE 79.9449% -28 - C1 -3JUK 8.1 ?
4 PsiBlast_PDB 79.8642% -41 - C1 -2PA4 6.8 ?
33 PsiBlast_CBE 79.5742% -39 - C1 -2PA4 5.9 ?
31 PsiBlast_CBE 78.8742% -42 - C1 -2PA4 6.8 ?
28 PsiBlast_CBE 78.4949% -24 - C1 -3JUK 8.0 ?
73 HHSearch 78.1342% -37 - C1 -2PA4 6.8 ?
61 PsiBlast_CBE 63.3231% -71 - C1 -1MP5 4.8 RMLA_SALTY
42 PsiBlast_CBE 60.1031% -70 - C1 -1MP4 4.7 RMLA_SALTY
65 PsiBlast_CBE 59.7731% -67 - C1 -1MP3 5.0 RMLA_SALTY
62 PsiBlast_CBE 59.6131% -67 - C1 -1MP5 5.1 RMLA_SALTY
47 PsiBlast_CBE 58.9331% -67 - C1 -1IIN 6.4 RMLA_SALTY
64 PsiBlast_CBE 58.8331% -70 - C1 -1MP5 4.7 RMLA_SALTY
16 PsiBlast_PDB 58.7431% -68 - C1 -1H5S 3.6 RMLA1_ECOLI
63 PsiBlast_CBE 58.2231% -71 - C1 -1MP5 5.0 RMLA_SALTY
43 PsiBlast_CBE 58.0331% -68 - C1 -1MP4 5.1 RMLA_SALTY
46 PsiBlast_CBE 57.7831% -68 - C1 -1IIN 4.8 RMLA_SALTY
48 PsiBlast_CBE 57.6431% -69 - C1 -1IIN 4.7 RMLA_SALTY
14 PsiBlast_PDB 57.5431% -64 - C1 -1H5T 5.6 RMLA1_ECOLI
45 PsiBlast_CBE 56.9531% -67 - C1 -1IIN 5.6 RMLA_SALTY
37 PsiBlast_CBE 56.6931% -63 - C1 -1H5R 3.3 RMLA1_ECOLI
41 PsiBlast_CBE 55.5931% -65 - C1 -1H5S 4.3 RMLA1_ECOLI
36 PsiBlast_CBE 55.4431% -61 - C1 -1H5R 3.4 RMLA1_ECOLI
34 PsiBlast_CBE 55.2731% -63 - C1 -1H5T 5.9 RMLA1_ECOLI
38 PsiBlast_CBE 55.0431% -68 - C1 -1H5T 5.3 RMLA1_ECOLI
15 PsiBlast_PDB 54.7031% -62 - C1 -1H5R 4.2 RMLA1_ECOLI
35 PsiBlast_CBE 53.8731% -61 - C1 -1H5T 6.0 RMLA1_ECOLI
39 PsiBlast_CBE 52.8731% -63 - C1 -1H5S 2.6 RMLA1_ECOLI
44 PsiBlast_CBE 52.3831% -69 - C1 -1H5S 3.6 RMLA1_ECOLI
40 PsiBlast_CBE 51.3631% -65 - C1 -1H5R 3.0 RMLA1_ECOLI