@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu18410: (2016-06-29 )
MKRTWNVCLTALLSVLLVAGSVPFHAEAKKPPKSYDEYKQVDVGKDGMVATAHPLASEIGADVLKKGGNAIDAAVAIQFALNVTEPMMSGIGGGGFMMVYDGKTKDTTIIDSRERAPAGATPDMFLDENGKAIPFSERVTKGTAVGVPGTLKGLEEALDKWGTRSMKQLITPSIKLAEKGFPIDSVLAEAISDYQEKLSRTAAKDVFLPNGEPLKEGDTLIQKDLAKTFKLIRSKGTDAFYKGKFAKTLSDTVQDFGGSMTEKDLENYDITIDEPIWGDYQGYQIATTPPPSSGGIFLLQMLKILDHFNLSQYDVRSWEKYQLLAETMHLSYADRASYAGDPEFVNVPLKGLLHPDYIKERQQLINLDQVNKKPKAGDPWKYQEGSANYKQVEQPKDKVEGQTTHFTVADRWGNVVSYTTTIEQLFGTGIMVPDYGVILNNELTDFDAIPGGANEVQPNKRPLSSMTPTILFKDDKPVLTVGSPGGATIISSVLQTILYHIEYGMELKAAVEEPRIYTNSMSSYRYEDGVPKDVLSKLNGMGHKFGTSPVDIGNVQSISIDHENGTFKGVADSSRNGAAIGINLKRK

Atome Classification :

(49 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GLU_B_5(3A75)
?
[Raw transfer]




AVN_B_3(3WHS)
GGT_BACSU
[Raw transfer]




GLU_D_6(3A75)
?
[Raw transfer]




AVN_D_6(3FNM)
?
[Raw transfer]




GLU_B_4(4OTU)
?
[Raw transfer]




AZS_D_6(2Z8I)
?
[Raw transfer]




AVN_B_5(3FNM)
?
[Raw transfer]




GTB_B_5(2QMC)
?
[Raw transfer]




GLU_B_5(2QM6)
?
[Raw transfer]




GTB_B_5(2QMC)
?
[Raw transfer]




GLU_D_6(2QM6)
?
[Raw transfer]




GLU_B_7(2DG5)
?
[Raw transfer]




GTB_D_6(2QMC)
?
[Raw transfer]




GLU_B_11(4GDX)
GGT1_HUMAN
[Raw transfer]




GLU_B_5(3A75)
?
[Raw transfer]




GLU_D_6(3A75)
?
[Raw transfer]




GLU_B_4(4OTU)
?
[Raw transfer]




GLU_B_7(2DG5)
?
[Raw transfer]




AVN_B_3(3WHS)
?
[Raw transfer]




GTB_B_5(2QMC)
?
[Raw transfer]




GLU_D_6(2QM6)
?
[Raw transfer]




AZS_B_5(2Z8J)
GGT_ECOLI
[Raw transfer]




GLU_B_12(4ZCG)
?
[Raw transfer]




SEE_B_11(4ZC6)
?
[Raw transfer]




GTB_B_5(2QMC)
?
[Raw transfer]




GTB_D_6(2QMC)
?
[Raw transfer]




GLU_B_11(4GDX)
?
[Raw transfer]




AVN_D_6(2Z8K)
?
[Raw transfer]




GLU_S_6(3G9K)
?
[Raw transfer]




AZS_D_6(2Z8J)
?
[Raw transfer]




AVN_B_5(2Z8K)
?
[Raw transfer]




AVN_B_5(3FNM)
?
[Raw transfer]




GLU_B_14(4GG2)
?
[Raw transfer]




GLU_B_11(4GDX)
?
[Raw transfer]




GLU_B_5(2QM6)
?
[Raw transfer]




AZS_D_6(2Z8I)
?
[Raw transfer]




AZS_B_5(2Z8I)
?
[Raw transfer]




AVN_D_6(3FNM)
?
[Raw transfer]




1 PsiBlast_PDB 82.4475% -54 * C3 *4Y23 - ? -
57 HHSearch 81.1675% -35 - C3 -4Y23 - ? -
3 PsiBlast_PDB 65.28100% -58 - C3 -3WHR - ? -
6 PsiBlast_PDB 64.6699% -58 - C3 -3A75 2.7 ?
4 PsiBlast_PDB 64.59100% -58 - C3 -3WHS 2.9 GGT_BACSU
2 PsiBlast_PDB 64.48100% -58 - C3 -3WHQ - GGT_BACSU -
5 PsiBlast_PDB 64.2699% -53 - C3 -2V36 - GGT_BACSU -
21 PsiBlast_CBE 64.0199% -53 - C3 -3A75 2.8 ?
61 HHSearch 63.06100% -70 - C3 -3WHR - ? -
8 PsiBlast_PDB 58.6973% -53 - C3 -4OTU 2.6 ?
7 PsiBlast_PDB 58.1873% -58 - C3 -4OTT - ? -
59 HHSearch 54.4629% -6 - C- -2NLZ - ? -
60 HHSearch 52.3224% -10 - C3 -2I3O - ? -
64 HHSearch 44.9741% 2 - C3 -2QMC 2.4 ?
65 HHSearch 44.5335% -86 - C3 -3G9K - CAPD_BACAN -
63 HHSearch 44.2343% 13 - C3 -2DG5 2.7 ?
62 HHSearch 43.7229% -37 - C3 -4GDX - GGT1_HUMAN -
29 PsiBlast_CBE 43.6843% 26 - C3 -2Z8I 2.7 ?
14 PsiBlast_PDB 43.4641% 25 - C3 -3FNM 2.8 ?
12 PsiBlast_PDB 43.4041% 30 - C3 -2QM6 2.7 ?
32 PsiBlast_CBE 43.3941% 26 - C3 -2QM6 2.7 ?
13 PsiBlast_PDB 43.3741% 29 - C3 -2QMC 2.4 ?
30 PsiBlast_CBE 43.1241% 27 - C3 -3FNM 2.8 ?
31 PsiBlast_CBE 42.9941% 28 - C3 -2QMC 2.4 ?
24 PsiBlast_CBE 37.98100% -39 - C3 -3A75 4.5 ?
33 PsiBlast_CBE 37.5232% 14 - C3 -4GDX 2.9 GGT1_HUMAN
23 PsiBlast_CBE 37.50100% -31 - C3 -3A75 4.5 ?
22 PsiBlast_CBE 37.07100% -35 - C3 -3WHS 4.2 ?
25 PsiBlast_CBE 35.1979% -38 - C3 -4OTU 3.9 ?
39 PsiBlast_CBE 28.6444% -7 - C3 -3FNM 3.9 ?
44 PsiBlast_CBE 28.2243% -9 - C3 -2QMC 3.7 ?
41 PsiBlast_CBE 28.0344% -4 - C3 -2QM6 3.4 ?
40 PsiBlast_CBE 27.9544% -3 - C3 -3FNM 3.6 ?
42 PsiBlast_CBE 27.7344% -6 - C3 -2QM6 3.4 ?
43 PsiBlast_CBE 27.6943% -7 - C3 -2QMC 3.3 ?
68 HHSearch 27.4534% -6 - C3 -4GDX 3.8 ?
49 PsiBlast_CBE 27.3340% 8 - C3 -2Z8I 3.4 ?
70 HHSearch 27.0443% 6 - C3 -2QMC 3.9 ?
67 HHSearch 26.6242% 11 - C3 -2DG5 3.6 ?
50 PsiBlast_CBE 26.3340% 10 - C3 -2Z8I 3.4 ?
46 PsiBlast_CBE 26.2240% 10 - C3 -2Z8K 3.2 ?
45 PsiBlast_CBE 26.2240% 8 - C3 -2Z8K 3.7 ?
48 PsiBlast_CBE 26.2040% 7 - C3 -2Z8J 1.9 GGT_ECOLI
47 PsiBlast_CBE 25.8840% 5 - C3 -2Z8J 1.8 ?
52 PsiBlast_CBE 25.7932% -7 - C3 -4ZCG 3.2 ?
56 PsiBlast_CBE 25.6432% -4 - C3 -4GG2 3.7 ?
53 PsiBlast_CBE 25.2532% -5 - C3 -4ZC6 4.3 ?
51 PsiBlast_CBE 25.0332% -4 - C3 -4GDX 3.8 ?
69 HHSearch 23.2732% 17 - C3 -3G9K 3.4 ?