@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu18500: (2016-06-30 )
MQSLQHKTALITGGGRGIGRATALALAKEGVNIGLIGRTSANVEKVAEEVKALGVKAAFAAADVKDADQVNQAVAQVKEQLGDIDILINNAGISKFGGFLDLSADEWENIIQVNLMGVYHVTRAVLPEMIERKAGDIINISSTAGQRGAAVTSAYSASKFAVLGLTESLMQEVRKHNIRVSALTPSTVASDMSIELNLTDGNPEKVMQPEDLAEYMVAQLKLDPRIFIKTAGLWSTNP

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PEG_A_6(3OSU)
FABG_STAAM
[Raw transfer]




THJ_A_4(3GED)
?
[Raw transfer]




PEG_A_3(3OSU)
FABG_STAAM
[Raw transfer]




1 PsiBlast_PDB 82.5234% -73 - C1 -2C07 - ? -
118 HHSearch 76.7529% -98 - C1 -4J2H - ? -
127 HHSearch 75.7131% -56 - C1 -4URF - ? -
129 HHSearch 75.4428% -65 - C1 -3AI3 - ? -
86 PsiBlast_CBE 75.3735%-112 - C1 -4BNU - FABG_PSEAE -
51 PsiBlast_CBE 75.3235%-113 - C1 -4BO4 - FABG_PSEAE -
59 PsiBlast_CBE 75.0535%-113 - C1 -4BO2 - FABG_PSEAE -
72 PsiBlast_CBE 74.6835%-109 - C1 -4BNZ - FABG_PSEAE -
77 PsiBlast_CBE 74.2935%-116 - C1 -4BNX - FABG_PSEAE -
45 PsiBlast_CBE 74.1235%-116 - C1 -4BO6 - FABG_PSEAE -
64 PsiBlast_CBE 73.8935%-114 - C1 -4BO1 - FABG_PSEAE -
39 PsiBlast_CBE 73.8235%-120 - C1 -4BO8 - FABG_PSEAE -
38 PsiBlast_CBE 73.6935%-112 - C1 -4BO8 - FABG_PSEAE -
87 PsiBlast_CBE 73.5835%-118 - C1 -4BNU - FABG_PSEAE -
80 PsiBlast_CBE 73.5235%-112 - C1 -4BNW - FABG_PSEAE -
73 PsiBlast_CBE 73.4535%-110 - C1 -4BNY - FABG_PSEAE -
54 PsiBlast_CBE 73.4535%-123 - C1 -4BO4 - FABG_PSEAE -
125 HHSearch 73.4430% -72 - C1 -3WDS - ? -
57 PsiBlast_CBE 73.4335%-121 - C1 -4BO3 - FABG_PSEAE -
19 PsiBlast_PDB 73.2935%-104 - C1 -4BNW - FABG_PSEAE -
7 PsiBlast_PDB 65.4538% -30 - C1 -3OSU 2.3 FABG_STAAM