@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu18840: (2016-06-30 )
MFKFKKNFLVGLSAALMSISLFSATASAASTDYWQNWTDGGGIVNAVNGSGGNYSVNWSNTGNFVVGKGWTTGSPFRTINYNAGVWAPNGNGYLTLYGWTRSPLIEYYVVDSWGTYRPTGTYKGTVKSDGGTYDIYTTTRYNAPSIDGDRTTFTQYWSVRQSKRPTGSNATITFSNHVNAWKSHGMNLGSNWAYQVMATEGYQSSGSSNVTVW

Atome Classification :

(61 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SUGAR_B_5(2QZ3)
XYNA_BACSU
[Raw transfer]

-

GOL_A_5(2Z79)
XYNA_BACSU
[Raw transfer]




GOL_B_9(2Z79)
XYNA_BACSU
[Raw transfer]




SUGAR_B_2(2B46)
XYNA_BACSU
[Raw transfer]

-

SUGAR_A_3(2QZ3)
XYNA_BACSU
[Raw transfer]

-

GOL_A_5(2Z79)
XYNA_BACSU
[Raw transfer]




SUGAR_B_2(1BCX)
XYNA_BACCI
[Raw transfer]

-

FXP_A_2(3ZSE)
?
[Raw transfer]




BXP_B_4(2NQY)
?
[Raw transfer]




XYP_B_2(1BVV)
XYNA_BACCI
[Raw transfer]




GOL_A_2(3AKS)
?
[Raw transfer]




GOL_A_2(2VUJ)
?
[Raw transfer]




GOL_B_5(3AKP)
?
[Raw transfer]




GOL_B_5(3AKT)
?
[Raw transfer]




GOL_A_2(3AKR)
?
[Raw transfer]




BXP_A_3(2NQY)
?
[Raw transfer]




FXP_A_3(1H4G)
?
[Raw transfer]




FXP_B_4(1QH6)
?
[Raw transfer]




EPE_B_2(2B45)
XYNA_BACSU
[Raw transfer]




FXP_B_5(1H4G)
?
[Raw transfer]




FXP_A_3(1QH6)
?
[Raw transfer]




GOL_A_4(3AKP)
?
[Raw transfer]




GOL_A_4(3AKT)
?
[Raw transfer]




XYP_B_2(1C5I)
XYNA_BACCI
[Raw transfer]




XS2_A_6(1XNK)
?
[Raw transfer]




DFX_B_3(1C5I)
XYNA_BACCI
[Raw transfer]




FXP_A_3(1H4G)
?
[Raw transfer]




SUGAR_A_2(4HK9)
XYN2_HYPJE
[Raw transfer]

-

SUGAR_A_2(4HK8)
XYN2_HYPJE
[Raw transfer]

-

C5X_C_3(1RED)
XYN2_HYPJE
[Raw transfer]




XYP_A_3(1QH7)
?
[Raw transfer]




C3X_D_4(1REF)
XYN2_HYPJE
[Raw transfer]




DIO_C_6(2DCY)
XYNA_BACSU
[Raw transfer]




SUGAR_A_2(3VZO)
XYNA_BACCI
[Raw transfer]

-

XYP_B_4(1QH7)
?
[Raw transfer]




C4X_C_3(1REE)
XYN2_HYPJE
[Raw transfer]




SUGAR_B_4(3VZN)
XYNA_BACCI
[Raw transfer]

-

SUGAR_A_3(3VZN)
XYNA_BACCI
[Raw transfer]

-

SUGAR_A_2(3VZM)
XYNA_BACCI
[Raw transfer]

-

SUGAR_C_7(1H4H)
?
[Raw transfer]

-

12P_A_6(2VUL)
?
[Raw transfer]




SUGAR_B_6(1H4H)
?
[Raw transfer]

-

SUGAR_A_5(1H4H)
?
[Raw transfer]

-

TAR_B_11(2DCY)
XYNA_BACSU
[Raw transfer]




SUGAR_D_8(1H4H)
?
[Raw transfer]

-

MES_A_7(4XQW)
XYN2_HYPJE
[Raw transfer]




MES_A_3(4S2D)
XYN2_HYPJE
[Raw transfer]




MES_B_4(3EXU)
XYNA_BACSU
[Raw transfer]




SUGAR_A_2(4HKW)
XYN2_HYPJE
[Raw transfer]

-

SUGAR_A_3(2VGD)
?
[Raw transfer]

-

EDO_A_3(3ZSE)
?
[Raw transfer]




SUGAR_B_2(1M4W)
?
[Raw transfer]

-

MES_B_4(3EXU)
XYNA_BACSU
[Raw transfer]




EDO_A_5(3ZSE)
?
[Raw transfer]




EDO_A_15(1TE1)
XYNC_TALFU
[Raw transfer]




23 PsiBlast_CBE 86.40100% -32 - C8 -2DCY 2.3 XYNA_BACSU
3 PsiBlast_PDB 86.32100% -33 - C8 -2DCY - XYNA_BACSU -
25 PsiBlast_CBE 86.2199% -38 - C8 -2Z79 2.5 XYNA_BACSU
2 PsiBlast_PDB 86.08100% -33 - C8 -1XXN - XYNA_BACSU -
1 PsiBlast_PDB 86.0099% -27 - C8 -1AXK - GUB_PAEMA (first) -
13 PsiBlast_PDB 85.9899% -32 - C8 -2Z79 2.5 XYNA_BACSU
33 PsiBlast_CBE 85.8798% -40 - C8 -1BCX 5.5 XYNA_BACCI
12 PsiBlast_PDB 85.7699% -38 - C8 -2QZ3 6.2 XYNA_BACSU
26 PsiBlast_CBE 85.7599% -33 - C8 -2QZ3 6.8 XYNA_BACSU
24 PsiBlast_CBE 85.57100% -29 - C8 -2DCY 3.6 XYNA_BACSU
15 PsiBlast_PDB 85.5698% -33 - C8 -3VZO 3.3 XYNA_BACCI
6 PsiBlast_PDB 85.5199% -33 - C8 -1XNB - XYNA_BACCI -
22 PsiBlast_CBE 85.38100% -30 - C8 -2DCY - XYNA_BACSU -
34 PsiBlast_CBE 85.2498% -36 - C8 -2DCZ - XYNA_BACSU -
30 PsiBlast_CBE 85.1898% -32 - C8 -3VZN 3.2 XYNA_BACCI
5 PsiBlast_PDB 85.1599% -33 - C8 -1BVV 3.3 XYNA_BACCI
9 PsiBlast_PDB 85.0598% -33 - C8 -1HV0 - XYNA_BACCI -
35 PsiBlast_CBE 84.9998% -37 - C8 -2DCZ - XYNA_BACSU -
29 PsiBlast_CBE 84.9098% -32 - C8 -3VZL - XYNA_BACCI -
19 PsiBlast_PDB 84.8898% -34 - C8 -3VZM 4.1 XYNA_BACCI
11 PsiBlast_PDB 84.7498% -31 - C8 -1C5I 3.3 XYNA_BACCI
17 PsiBlast_PDB 84.7298% -28 - C8 -3VZN 2.9 XYNA_BACCI
37 PsiBlast_CBE 84.4998% -36 - C8 -3EXU 2.3 XYNA_BACSU
38 PsiBlast_CBE 84.2398% -28 - C8 -2B46 5.4 XYNA_BACSU
39 PsiBlast_CBE 84.1598% -28 - C8 -2B45 3.6 XYNA_BACSU
118 HHSearch 75.0998% -9 - C8 -2Z79 2.5 XYNA_BACSU
36 PsiBlast_CBE 71.2198% -40 - C8 -3EXU 3.1 XYNA_BACSU
40 PsiBlast_CBE 68.0366% -42 - C8 -3ZSE 3.1 ?
41 PsiBlast_CBE 62.0467% -39 - C8 -1M4W 3.2 ?
49 PsiBlast_CBE 61.1555% -11 - C8 -2VUL 2.6 ?
47 PsiBlast_CBE 60.6756% -8 - C8 -2VGD 5.1 ?
46 PsiBlast_CBE 60.2956% -2 - C8 -2VUJ 3.9 ?
112 HHSearch 59.4657% -16 - C8 -1XNK 4.9 ?
76 PsiBlast_CBE 59.3852% -11 - C8 -4HK9 5.8 XYN2_HYPJE
73 PsiBlast_CBE 59.3452% -11 - C8 -1RED 3.0 XYN2_HYPJE
62 PsiBlast_CBE 59.2652% -10 - C8 -3AKT 3.7 ?
60 PsiBlast_CBE 59.2052% -8 - C8 -4HKW 4.5 XYN2_HYPJE
71 PsiBlast_CBE 58.9652% -6 - C8 -1REF 3.1 XYN2_HYPJE
68 PsiBlast_CBE 58.8952% -9 - C8 -3AKP 2.1 ?
63 PsiBlast_CBE 58.8352% -11 - C8 -3AKT 2.1 ?
67 PsiBlast_CBE 58.6452% -8 - C8 -3AKP 2.4 ?
75 PsiBlast_CBE 58.6052% -12 - C8 -4HK8 10.4 XYN2_HYPJE
81 PsiBlast_CBE 58.5552% -10 - C8 -4XQW 2.6 XYN2_HYPJE
64 PsiBlast_CBE 58.5552% -8 - C8 -3AKS 3.5 ?
72 PsiBlast_CBE 58.3052% -11 - C8 -1REE 3.0 XYN2_HYPJE
59 PsiBlast_CBE 58.1452% -7 - C8 -4S2D 2.1 XYN2_HYPJE
65 PsiBlast_CBE 58.1152% -6 - C8 -3AKR 2.3 ?
82 PsiBlast_CBE 57.7551% -17 - C8 -1TE1 2.8 XYNC_TALFU
91 PsiBlast_CBE 57.5150% 31 - C8 -1H4G 3.7 ?
89 PsiBlast_CBE 57.1650% 28 - C8 -1QH6 3.3 ?
98 PsiBlast_CBE 57.1449% 25 - C8 -1H4H 4.5 ?
92 PsiBlast_CBE 57.0350% 31 - C8 -1H4G 3.6 ?
88 PsiBlast_CBE 56.7050% 32 - C8 -1QH7 3.0 ?
96 PsiBlast_CBE 56.6049% 29 - C8 -1H4H 4.2 ?
93 PsiBlast_CBE 56.5150% 30 - C8 -2NQY 4.5 ?
94 PsiBlast_CBE 56.5050% 28 - C8 -2NQY 5.1 ?
87 PsiBlast_CBE 56.0450% 29 - C8 -1QH7 2.9 ?
90 PsiBlast_CBE 56.0250% 36 - C8 -1QH6 3.6 ?
97 PsiBlast_CBE 55.9349% 28 - C8 -1H4H 5.7 ?
95 PsiBlast_CBE 55.8949% 35 - C8 -1H4H 4.9 ?
120 HHSearch 54.3449% 32 - C8 -1H4G 3.6 ?