@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu19630: (2016-07-01 )
MSVHIGAEKGQIADTVLLPGDPLRAKFIAETYLENVECYNEVRGMYGFTGTYKGKKISVQGTGMGVPSISIYVNELIQSYDVQNLIRVGSCGAIRKDVKVRDVILAMTSSTDSQMNRVAFGSVDFAPCADFELLKNAYDAAKDKGVPVTVGSVFTADQFYNDDSQIEKLAKYGVLGVEMETTALYTLAAKHGRKALSILTVSDHVLTGEETTAEERQTTFHDMIEVALHSVSQ

Atome Classification :

(59 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

2FA_A_3(4DAN)
DEOD_BACSU
[Raw transfer]




2FA_B_4(4DAN)
DEOD_BACSU
[Raw transfer]




ADN_A_2(3UAW)
DEOD_BACCE
[Raw transfer]




ADN_A_2(3UAW)
DEOD_BACCE
[Raw transfer]




ADN_A_2(3UAY)
DEOD_BACCE
[Raw transfer]




ADN_M_13(2AC7)
DEOD_BACAN
[Raw transfer]




2FA_Q_17(1PK9)
DEOD_ECO57
[Raw transfer]




ADN_P_16(2AC7)
DEOD_BACAN
[Raw transfer]




FMC_A_4(3UT6)
DEOD_ECOLI
[Raw transfer]




FMC_C_9(3UT6)
DEOD_ECOLI
[Raw transfer]




FMB_Q_17(1PR1)
DEOD_ECO57
[Raw transfer]




FMC_B_6(3UT6)
DEOD_ECOLI
[Raw transfer]




TBN_Q_17(1PR5)
DEOD_ECO57
[Raw transfer]




XYA_M_13(1PR6)
DEOD_ECO57
[Raw transfer]




XYA_Q_17(1PR6)
DEOD_ECO57
[Raw transfer]




NOS_A_2(3UAZ)
DEOD_BACCE
[Raw transfer]




TBN_A_2(4DAR)
DEOD_BACSU
[Raw transfer]




ADN_A_3(4D9H)
DEOD_BACSU
[Raw transfer]




NOS_Q_17(1PR0)
DEOD_ECO57
[Raw transfer]




NOS_M_13(1PR0)
DEOD_ECO57
[Raw transfer]




TBN_O_15(1PR5)
DEOD_ECO57
[Raw transfer]




6CR_A_2(4DAE)
DEOD_BACSU
[Raw transfer]




TBN_M_13(1PR5)
DEOD_ECO57
[Raw transfer]




NOS_O_15(1PR0)
DEOD_ECO57
[Raw transfer]




FMB_O_15(1PR1)
DEOD_ECO57
[Raw transfer]




2FD_Q_17(1PKE)
DEOD_ECO57
[Raw transfer]




MTP_Q_17(1PR4)
DEOD_ECO57
[Raw transfer]




XYA_O_15(1PR6)
DEOD_ECO57
[Raw transfer]




2FD_M_13(1PKE)
DEOD_ECO57
[Raw transfer]




FMB_M_13(1PR1)
DEOD_ECO57
[Raw transfer]




2FD_O_15(1PKE)
DEOD_ECO57
[Raw transfer]




GNG_A_2(4DA0)
DEOD_BACSU
[Raw transfer]




AC2_A_2(4DA7)
DEOD_BACSU
[Raw transfer]




RAB_Q_17(1PW7)
DEOD_ECO57
[Raw transfer]




2FD_G_7(1Z34)
?
[Raw transfer]




GA2_A_2(4DA6)
DEOD_BACSU
[Raw transfer]




RAB_O_15(1PW7)
DEOD_ECO57
[Raw transfer]




MTP_O_15(1PR4)
DEOD_ECO57
[Raw transfer]




MTP_M_13(1PR4)
DEOD_ECO57
[Raw transfer]




RAB_M_13(1PW7)
DEOD_ECO57
[Raw transfer]




BG2_A_2(4DA8)
DEOD_BACSU
[Raw transfer]




MDR_Q_17(1PR2)
DEOD_ECO57
[Raw transfer]




ADE_B_8(4D8V)
DEOD_BACSU
[Raw transfer]




MDR_O_15(1PR2)
DEOD_ECO57
[Raw transfer]




MDR_M_13(1PR2)
DEOD_ECO57
[Raw transfer]




ADE_A_3(4DAO)
DEOD_BACSU
[Raw transfer]




ADE_B_4(4DAO)
DEOD_BACSU
[Raw transfer]




HPA_A_2(4DAB)
DEOD_BACSU
[Raw transfer]




TRS_M_13(1JE0)
PNPH_SULSO
[Raw transfer]




DMS_A_15(4MCH)
?
[Raw transfer]




4 PsiBlast_PDB 94.4499%-111 - C3 -4D98 - DEOD_BACSU -
25 PsiBlast_CBE 94.2699%-110 - C3 -4D8Y - DEOD_BACSU -
10 PsiBlast_PDB 94.1999%-113 - C3 -4DAB 3.3 DEOD_BACSU
7 PsiBlast_PDB 94.1199%-113 - C3 -4DA6 4.8 DEOD_BACSU
29 PsiBlast_CBE 94.0899%-113 - C3 -4D8Y - DEOD_BACSU -
13 PsiBlast_PDB 93.9699%-117 - C3 -4DAO 3.1 DEOD_BACSU
8 PsiBlast_PDB 93.9599%-113 - C3 -4DA7 4.4 DEOD_BACSU
28 PsiBlast_CBE 93.9399%-114 - C3 -4D8Y - DEOD_BACSU -
12 PsiBlast_PDB 93.7499%-114 - C3 -4DAN 5.2 DEOD_BACSU
30 PsiBlast_CBE 93.6299%-112 - C3 -4D8V 3.1 DEOD_BACSU
5 PsiBlast_PDB 93.6299%-113 - C3 -4D9H 4.8 DEOD_BACSU
26 PsiBlast_CBE 93.5599%-115 - C3 -4D8Y - DEOD_BACSU -
14 PsiBlast_PDB 93.3699%-116 - C3 -4DAR 4.6 DEOD_BACSU
11 PsiBlast_PDB 93.3699%-112 - C3 -4DAE 5.5 DEOD_BACSU
21 PsiBlast_CBE 93.2699%-110 - C3 -4DAO 3.2 DEOD_BACSU
22 PsiBlast_CBE 93.2499%-115 - C3 -4DAN 5.2 DEOD_BACSU
2 PsiBlast_PDB 92.9199%-116 - C- -4D8X - DEOD_BACSU -
27 PsiBlast_CBE 92.7099%-112 - C3 -4D8Y - DEOD_BACSU -
1 PsiBlast_PDB 92.6199%-109 - C3 -4D8V - DEOD_BACSU -
24 PsiBlast_CBE 92.1599%-109 - C3 -4D98 - DEOD_BACSU -
9 PsiBlast_PDB 92.0499%-113 - C3 -4DA8 5.0 DEOD_BACSU
6 PsiBlast_PDB 91.3999%-109 - C3 -4DA0 4.9 DEOD_BACSU
17 PsiBlast_PDB 84.2371% -96 - C3 -3UAY 5.0 DEOD_BACCE
18 PsiBlast_PDB 83.4871% -96 - C3 -3UAZ 4.9 DEOD_BACCE
16 PsiBlast_PDB 82.9271% -92 - C3 -3UAW 5.1 DEOD_BACCE
15 PsiBlast_PDB 82.0071%-102 - C3 -2AC7 5.1 DEOD_BACAN
31 PsiBlast_CBE 81.8471%-102 - C3 -2AC7 5.1 DEOD_BACAN
110 HHSearch 81.2170% -86 - C3 -3UAW 5.1 DEOD_BACCE
75 PsiBlast_CBE 80.9458%-103 - C3 -3UT6 4.5 DEOD_ECOLI
45 PsiBlast_CBE 80.8858%-103 - C3 -1PR6 4.9 DEOD_ECO57
58 PsiBlast_CBE 80.4558%-109 - C3 -1PR1 4.5 DEOD_ECO57
76 PsiBlast_CBE 80.2058%-104 - C3 -3UT6 4.1 DEOD_ECOLI
52 PsiBlast_CBE 80.0958%-106 - C3 -1PR4 5.1 DEOD_ECO57
106 PsiBlast_CBE 79.8358%-106 - C3 -1PKE 4.5 DEOD_ECO57
56 PsiBlast_CBE 79.8158%-102 - C3 -1PR2 5.0 DEOD_ECO57
51 PsiBlast_CBE 79.4858%-100 - C3 -1PR4 5.2 DEOD_ECO57
55 PsiBlast_CBE 79.4658%-106 - C3 -1PR2 5.0 DEOD_ECO57
44 PsiBlast_CBE 79.1058%-103 - C3 -1PW7 4.2 DEOD_ECO57
107 PsiBlast_CBE 79.0958%-103 - C3 -1PKE 4.9 DEOD_ECO57
53 PsiBlast_CBE 78.7458%-110 - C3 -1PR4 5.3 DEOD_ECO57
108 PsiBlast_CBE 78.6858% -99 - C3 -1PK9 5.4 DEOD_ECO57
42 PsiBlast_CBE 78.6658%-105 - C3 -1PW7 4.2 DEOD_ECO57
62 PsiBlast_CBE 78.5858%-106 - C3 -1PR0 4.8 DEOD_ECO57
43 PsiBlast_CBE 78.5658%-105 - C3 -1PW7 4.2 DEOD_ECO57
105 PsiBlast_CBE 78.4358% -98 - C3 -1PKE 4.9 DEOD_ECO57
54 PsiBlast_CBE 78.3558% -98 - C3 -1PR2 5.5 DEOD_ECO57
49 PsiBlast_CBE 78.2958%-112 - C3 -1PR5 4.7 DEOD_ECO57
46 PsiBlast_CBE 78.2058%-104 - C3 -1PR6 4.7 DEOD_ECO57
59 PsiBlast_CBE 77.9258%-112 - C3 -1PR1 4.4 DEOD_ECO57
60 PsiBlast_CBE 77.8858%-101 - C3 -1PR0 5.1 DEOD_ECO57
77 PsiBlast_CBE 77.7558% -98 - C3 -3UT6 4.8 DEOD_ECOLI
61 PsiBlast_CBE 77.3158%-104 - C3 -1PR0 4.4 DEOD_ECO57
50 PsiBlast_CBE 77.1158%-112 - C3 -1PR5 4.6 DEOD_ECO57
47 PsiBlast_CBE 76.9258%-107 - C3 -1PR6 4.9 DEOD_ECO57
57 PsiBlast_CBE 76.7658% -97 - C3 -1PR1 4.4 DEOD_ECO57
48 PsiBlast_CBE 73.5058% -98 - C3 -1PR5 4.7 DEOD_ECO57
121 HHSearch 73.1445% -97 - C3 -1Z34 4.7 ?
125 HHSearch 64.6031% -73 - C3 -1JE0 3.5 PNPH_SULSO
127 HHSearch 62.1631% -92 - C3 -4MCH 3.3 ?