@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu19740: (2016-07-01 )
MSSYLIKPELSSAYPVVSYAKGSYVYDQTGKKYLDGSSGAVTCNIGHGVRDVTEKLKEQLDQVSFAYRSQFTSEPAEQLAALLAQELPGDVNWSFFVNSGSEAIETAMKIAIQYWQEKKQTQKSIFLSRWSSYHGITLGALSLSGFYERRYRFTHLIERYPAISAPHIYRLNHETEEDFVQTAADELDTMIKRIGSQFIAGFVAEPIIGAAGAAITPPPGYYERLSEVCRTHDVLFIADEVMTGLGRTGRMLATEHWDTVPDIAVLGKGLGAGYAPIAAAVVSDSIIETIKQGSGVIMSGHTYSAHPYSAKAALEVLRYVLKHGLIKQSEKKGAVLKKKLDEAASQSGIIGEVRGKGLLLGIEFVADQKTKKVFPPEQAITQLIVSEAKKRGLIVYPSKAGIDSGEGDAVIIAPPFTISDGEMEELISIFSETVAAVEKNLKKD

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PLP_A_3(4NOG)
?
[Raw transfer]




PLP_B_6(1S07)
BIOA_ECOLI
[Raw transfer]




TA8_B_4(4A6R)
?
[Raw transfer]




PLP_B_8(1MLZ)
BIOA_ECOLI
[Raw transfer]




PLP_A_5(1S07)
BIOA_ECOLI
[Raw transfer]




PLP_A_3(3DOD)
BIOK_BACSU
[Raw transfer]




TA8_A_3(4A6R)
?
[Raw transfer]




PLP_A_4(4PPM)
?
[Raw transfer]




PLP_B_8(1MLY)
BIOA_ECOLI
[Raw transfer]




PLP_A_5(1MGV)
BIOA_ECOLI
[Raw transfer]




PLP_B_6(1MGV)
BIOA_ECOLI
[Raw transfer]




PLP_B_6(1QJ3)
BIOA_ECOLI
[Raw transfer]




PLP_B_6(1QJ5)
BIOA_ECOLI
[Raw transfer]




KAP_B_7(1QJ3)
BIOA_ECOLI
[Raw transfer]




ACZ_B_4(1MLY)
BIOA_ECOLI
[Raw transfer]




10 PsiBlast_PDB 80.9129% -59 - C1 -3I5T - ? -
70 HHSearch 80.7029% -52 - C1 -3I5T - ? -
32 PsiBlast_CBE 78.9831% -19 - C1 -4A6T - ? -
27 PsiBlast_CBE 78.8731% -19 - C1 -4AH3 - ? -
31 PsiBlast_CBE 78.4331% -19 - C1 -4A6T - ? -
29 PsiBlast_CBE 78.3531% -19 - C1 -4A72 - ? -
6 PsiBlast_PDB 78.2531% -18 - C1 -4AH3 - ? -
8 PsiBlast_PDB 78.1731% -19 - C1 -4BA5 - ? -
33 PsiBlast_CBE 78.0231% -18 - C1 -4A6T - ? -
3 PsiBlast_PDB 77.5631% -21 - C1 -4A6R - ? -
7 PsiBlast_PDB 77.4831% -22 - C1 -4BA4 - ? -
24 PsiBlast_CBE 77.4331% -17 - C1 -4BA5 - ? -
4 PsiBlast_PDB 77.2431% -17 - C1 -4A6T - ? -
28 PsiBlast_CBE 77.0331% -20 - C1 -4AH3 - ? -
25 PsiBlast_CBE 76.9831% -22 - C1 -4BA4 - ? -
26 PsiBlast_CBE 76.6731% -18 - C1 -4AH3 - ? -
34 PsiBlast_CBE 76.4131% -22 - C1 -4A6R 2.8 ?
30 PsiBlast_CBE 76.0231% -19 - C1 -4A72 - ? -
77 HHSearch 75.8030% -23 - C1 -4A6R 2.6 ?
9 PsiBlast_PDB 75.6534% -30 - C1 -3N5M - ? -
83 HHSearch 68.1431% -18 - C1 -4PPM 2.8 ?
60 PsiBlast_CBE 43.3433% -47 - C1 -1MGV 3.5 BIOA_ECOLI
57 PsiBlast_CBE 43.0933% -65 - C1 -1QJ3 3.5 BIOA_ECOLI
62 PsiBlast_CBE 42.1532% -49 - C1 -1S07 4.1 BIOA_ECOLI
58 PsiBlast_CBE 42.1233% -46 - C1 -1MLZ 2.9 BIOA_ECOLI
63 PsiBlast_CBE 42.0332% -49 - C1 -1S07 2.3 BIOA_ECOLI
56 PsiBlast_CBE 41.6833% -49 - C1 -1QJ5 4.0 BIOA_ECOLI
61 PsiBlast_CBE 41.1433% -47 - C1 -1MGV 2.3 BIOA_ECOLI
59 PsiBlast_CBE 40.3933% -44 - C1 -1MLY 3.7 BIOA_ECOLI