@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu20020: (2016-07-02 )
MQIKIKYLDETQTRINKMEQGDWIDLRAAEDVAIKKDEFKLVPLGVAMELPEGYEAHVVPRSSTYKNFGVIQTNSMGVIDESYKGDNDFWFFPAYALRDTKIKKGDRICQFRIMKKMPAVDLIEVDRLGNGDRGGHGSTGTK

Atome Classification :

(37 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_C_12(2XCD)
YNCF_BACSU
[Raw transfer]




DUR_B_5(4AOZ)
YNCF_BACSU
[Raw transfer]




UMP_D_13(4AO5)
YOSS_BACSU
[Raw transfer]




UMP_A_7(4AO5)
YOSS_BACSU
[Raw transfer]




DUR_B_7(4B0H)
YNCF_BACSU
[Raw transfer]




DUP_C_9(2XY3)
YOSS_BACSU
[Raw transfer]




DUP_E_21(2XCE)
YNCF_BACSU
[Raw transfer]




DUD_E_11(2Y1T)
YOSS_BACSU
[Raw transfer]




DUP_F_25(2XCE)
YNCF_BACSU
[Raw transfer]




DUP_F_14(2XY3)
YOSS_BACSU
[Raw transfer]




UMP_E_15(4AO5)
YOSS_BACSU
[Raw transfer]




DUD_E_10(2Y1T)
YOSS_BACSU
[Raw transfer]




DUD_C_8(2Y1T)
YOSS_BACSU
[Raw transfer]




DUP_E_12(2XY3)
YOSS_BACSU
[Raw transfer]




DUD_D_9(2Y1T)
YOSS_BACSU
[Raw transfer]




UMP_F_17(4AO5)
YOSS_BACSU
[Raw transfer]




UMP_C_11(4AO5)
YOSS_BACSU
[Raw transfer]




DUP_D_11(2XY3)
YOSS_BACSU
[Raw transfer]




DUD_B_7(2Y1T)
YOSS_BACSU
[Raw transfer]




DUP_C_14(2XCE)
YNCF_BACSU
[Raw transfer]




DUP_A_7(2XY3)
YOSS_BACSU
[Raw transfer]




DUP_A_7(2XCE)
YNCF_BACSU
[Raw transfer]




DUP_B_12(2XCE)
YNCF_BACSU
[Raw transfer]




DUP_D_16(2XCE)
YNCF_BACSU
[Raw transfer]




DUP_B_8(2XY3)
YOSS_BACSU
[Raw transfer]




DUR_C_11(4B0H)
YNCF_BACSU
[Raw transfer]




DUR_C_11(4AOO)
YNCF_BACSU
[Raw transfer]




DUR_C_11(4AOZ)
YNCF_BACSU
[Raw transfer]




DUR_D_15(4AOO)
YNCF_BACSU
[Raw transfer]




DUR_B_8(4AOO)
YNCF_BACSU
[Raw transfer]




DUR_A_4(4B0H)
YNCF_BACSU
[Raw transfer]




DUR_A_4(4AOZ)
YNCF_BACSU
[Raw transfer]




38 PsiBlast_CBE 100.0092% 0 - C- -4APZ - YNCF_BACSU -
9 PsiBlast_PDB 100.0092% 0 - C- -4APZ - -
51 PsiBlast_CBE 94.6592%-122 - C7 -4AOZ Error YNCF_BACSU
55 PsiBlast_CBE 93.8192%-122 - C7 -4AOO 3.3 YNCF_BACSU
5 PsiBlast_PDB 93.79100%-134 - C7 -4AO5 - YOSS_BACSU -
36 PsiBlast_CBE 93.7792%-121 - C7 -4B0H Error YNCF_BACSU
8 PsiBlast_PDB 93.7792%-129 - C7 -4AOO - YNCF_BACSU -
52 PsiBlast_CBE 93.7192%-125 - C7 -4AOZ 3.3 YNCF_BACSU
54 PsiBlast_CBE 93.6292%-122 - C7 -4AOO 3.3 YNCF_BACSU
37 PsiBlast_CBE 93.4492%-117 - C7 -4B0H 3.3 YNCF_BACSU
31 PsiBlast_CBE 93.10100%-136 - C7 -4AO5 Error YOSS_BACSU
53 PsiBlast_CBE 92.9592%-127 - C7 -4AOO 3.3 YNCF_BACSU
11 PsiBlast_PDB 92.2092%-129 - C7 -4B0H 3.3 YNCF_BACSU
32 PsiBlast_CBE 92.01100%-125 - C7 -4AO5 3.6 YOSS_BACSU
3 PsiBlast_PDB 92.01100%-126 - C7 -2XY3 2.7 YOSS_BACSU
24 PsiBlast_CBE 91.84100%-134 - C7 -2Y1T - YOSS_BACSU -
28 PsiBlast_CBE 91.82100%-124 - C7 -2XY3 2.9 YOSS_BACSU
34 PsiBlast_CBE 91.77100%-134 - C7 -4AO5 Error YOSS_BACSU
4 PsiBlast_PDB 91.56100%-131 - C7 -2Y1T 3.5 YOSS_BACSU
22 PsiBlast_CBE 91.55100%-131 - C7 -2Y1T 4.1 YOSS_BACSU
33 PsiBlast_CBE 91.51100%-120 - C7 -4AO5 3.6 YOSS_BACSU
10 PsiBlast_PDB 91.4592%-126 - C7 -4AOZ 3.3 YNCF_BACSU
26 PsiBlast_CBE 91.43100%-117 - C7 -2XY3 3.2 YOSS_BACSU
27 PsiBlast_CBE 91.18100%-132 - C7 -2XY3 3.4 YOSS_BACSU
21 PsiBlast_CBE 91.13100%-128 - C7 -2Y1T 3.5 YOSS_BACSU
60 PsiBlast_CBE 90.6892%-128 - C7 -2XCE 3.1 YNCF_BACSU
23 PsiBlast_CBE 90.64100%-119 - C7 -2Y1T 3.6 YOSS_BACSU
57 PsiBlast_CBE 90.4192%-129 - C7 -2XCE 3.0 YNCF_BACSU
56 PsiBlast_CBE 90.2592%-124 - C7 -2XCE 3.4 YNCF_BACSU
58 PsiBlast_CBE 89.8592%-132 - C7 -2XCE 2.9 YNCF_BACSU
29 PsiBlast_CBE 89.52100%-121 - C7 -2XY3 2.8 YOSS_BACSU
35 PsiBlast_CBE 89.35100%-116 - C7 -4AO5 3.6 YOSS_BACSU
30 PsiBlast_CBE 89.04100%-117 - C7 -2XY3 2.7 YOSS_BACSU
65 PsiBlast_CBE 88.8192%-132 - C7 -2XCD Error YNCF_BACSU
7 PsiBlast_PDB 88.6292%-124 - C7 -2XCE 3.3 YNCF_BACSU
59 PsiBlast_CBE 88.5092%-119 - C7 -2XCE 3.3 YNCF_BACSU
25 PsiBlast_CBE 88.16100%-120 - C7 -2Y1T 3.3 YOSS_BACSU