@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu21050: (2016-07-02 )
MNKTELIAKVAEKQGVSKKEGAPSVEKVFDTISEALKSGEKVSIPGFGTFEVRERAARKGRNPQTGEEIDIPATKAPAFKPAKALKDAVKAK

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_F_2(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_I_3(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1P78)
DBH_NOSS1
[Raw transfer]

-

NACID_C_3(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_D_4(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_D_4(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_E_3(2IIE)

[Raw transfer]

-

NACID_E_3(1OUZ)
IHFB_ECOLI
[Raw transfer]

-

NACID_E_3(1OWG)
IHFB_ECOLI
[Raw transfer]

-

NACID_D_2(2HT0)
IHFB_ECOLI
[Raw transfer]

-

NACID_E_3(1OWF)
IHFB_ECOLI
[Raw transfer]

-

NACID_E_3(1OWF)
IHFB_ECOLI
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

NACID_F_2(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_E_3(2IIE)
IHFA_ECOLI
[Raw transfer]

-

NACID_E_3(1IHF)
IHFB_ECOLI
[Raw transfer]

-

NACID_E_3(2IIE)
IHFA_ECOLI
[Raw transfer]

-

NACID_I_3(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_4(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_D_2(1P78)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

50 HHSearch 83.6766% -27 - C9 -4QJU 6.3 DBH_STAAM
4 PsiBlast_PDB 83.6766% -27 - C9 -4QJU 6.3 DBH_STAAM
3 PsiBlast_PDB 82.0566% -43 - C9 -4QJN - DBH_STAAM -
2 PsiBlast_PDB 81.1471% -44 - C9 -1HUU - DBH_GEOSE -
1 PsiBlast_PDB 78.7971% -13 - C9 -1HUE - DBH_GEOSE -
37 Fugue 78.2266% -69 - C9 -1HUU - DBH_GEOSE -
6 PsiBlast_PDB 77.7961% -29 - C- -3RHI - ? -
21 PsiBlast_CBE 77.5266% -9 - C9 -4QJU 6.5 DBH_STAAM
5 PsiBlast_PDB 76.5666% -17 - C9 -5FBM - ? -
49 HHSearch 71.3454% -83 - C9 -1MUL - DBHA_ECOLI -
9 PsiBlast_PDB 71.3454% -83 - C9 -1MUL - DBHA_ECOLI -
52 HHSearch 70.9145% -25 - C9 -4PT4 - DBH_MYCTO (first) -
51 HHSearch 70.7258% -87 - C9 -1B8Z - DBH_THEMA -
29 PsiBlast_CBE 70.6940% -14 - C9 -2IIF - IHFA_ECOLI (first) -
13 PsiBlast_PDB 70.5157% -87 - C9 -1B8Z - DBH_THEMA -
17 PsiBlast_PDB 70.2440% 0 - C- -1IHF - -
58 HHSearch 70.1640% -21 - C9 -2IIE 7.6 IHFA_ECOLI (first)
36 PsiBlast_CBE 69.4246% -36 - C9 -4PT4 - DBH_MYCTO (first) -
30 PsiBlast_CBE 69.3440% -24 - C9 -2IIE 7.6 IHFA_ECOLI (first)
14 PsiBlast_PDB 69.2256% -30 - C9 -1RIY - DBH_THEMA -
27 PsiBlast_CBE 69.1050% -7 - C9 -1P51 4.8 DBH_NOSS1
24 PsiBlast_CBE 68.3750% -9 - C9 -1P71 1128214396763122245304320.0 DBH_NOSS1
10 PsiBlast_PDB 68.2450% -2 - C9 -1P51 4.2 DBH_NOSS1
26 PsiBlast_CBE 68.0350% -6 - C9 -1P51 5.6 DBH_NOSS1
25 PsiBlast_CBE 67.5550% -4 - C9 -1P51 4.3 DBH_NOSS1
48 HHSearch 67.4149% 2 - C9 -1P71 1128214396763122245304320.0 DBH_NOSS1
11 PsiBlast_PDB 67.1050% 1 - C9 -1P71 1128214396763122245304320.0 DBH_NOSS1
12 PsiBlast_PDB 66.9350% -12 - C9 -1P78 4.8 DBH_NOSS1
23 PsiBlast_CBE 66.4450% -14 - C9 -1P78 4.5 DBH_NOSS1
47 HHSearch 57.3335% 100 - C9 -1OWF 3.1 IHFB_ECOLI
32 PsiBlast_CBE 56.6537% 101 - C9 -1OUZ 1692321595144683367956480.0 IHFB_ECOLI
35 PsiBlast_CBE 56.2337% 113 - C9 -1IHF 3.1 IHFB_ECOLI
31 PsiBlast_CBE 56.1737% 100 - C9 -1OWF 3.1 IHFB_ECOLI
34 PsiBlast_CBE 55.2837% 112 - C9 -1OWG 1692321595144683367956480.0 IHFB_ECOLI
33 PsiBlast_CBE 54.9637% 109 - C9 -2HT0 4.2 IHFB_ECOLI
60 HHSearch 32.3636% 72 - C9 -2IIE 3.5