@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu21610: (2016-07-03 )
MKKVLLGFAAFTLSLSLAACSSNDSEKVSTEKETPQASTDVEKKTEQKESTKEKTADKSKEKDKKELVDVTLDRAVDGDTIKVTYNGNVDTVRYLLIDTPETKKPNSCVQPYGEDASKRNKELVNSGKLQLEFDKGDRRDKYGRLLAYVYVDGKSVQETLLKEGLARVAYVYEPNTKYIDQFKKDEQEAKSEKLSIWSKNGYVTDRGFNGCVKEKTTAVKKATTSKPAATQPTTPKASSETSTTTEKEASSETTGGTETFKNCTELRKKYPNGVPSSHPAYQSKMDRDHDNYACER

Atome Classification :

(77 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

THP_A_2(1JOK)
NUC_STAAU
[Raw transfer]




THP_A_2(3NP8)
NUC_STAAU
[Raw transfer]




THP_A_2(4LAA)
NUC_STAAU
[Raw transfer]




THP_A_3(4KV6)
NUC_STAAU
[Raw transfer]




THP_A_3(1SNC)
NUC_STAAU
[Raw transfer]




THP_A_2(3OSO)
NUC_STAAU
[Raw transfer]




THP_A_2(3NK9)
NUC_STAAU
[Raw transfer]




THP_A_3(1ENC)
NUC_STAAU
[Raw transfer]




THP_A_3(3MEH)
NUC_STAAU
[Raw transfer]




THP_A_3(1STG)
NUC_STAAU
[Raw transfer]




THP_A_3(4DF7)
NUC_STAAU
[Raw transfer]




THP_A_2(4R8N)
NUC_STAAU
[Raw transfer]




THP_A_3(5C5M)
NUC_STAAU
[Raw transfer]




THP_A_2(4IZ8)
NUC_STAAU
[Raw transfer]




THP_A_3(1SYF)
NUC_STAAU
[Raw transfer]




THP_A_3(1SYD)
NUC_STAAU
[Raw transfer]




THP_A_3(5DEH)
NUC_STAAU
[Raw transfer]




THP_A_3(4K5W)
NUC_STAAU
[Raw transfer]




THP_A_2(3NQT)
NUC_STAAU
[Raw transfer]




THP_A_2(4ODG)
NUC_STAAU
[Raw transfer]




THP_A_2(3MXP)
NUC_STAAU
[Raw transfer]




THP_A_3(3S9W)
NUC_STAAU
[Raw transfer]




THP_A_3(3TP8)
NUC_STAAU
[Raw transfer]




THP_A_3(5C6A)
NUC_STAAU
[Raw transfer]




THP_A_3(3R3O)
NUC_STAAW
[Raw transfer]




THP_A_2(4KTA)
NUC_STAAU
[Raw transfer]




THP_A_2(4J1M)
NUC_STAAU
[Raw transfer]




THP_A_3(5EKL)
NUC_STAAU
[Raw transfer]




THP_A_2(3PMF)
NUC_STAAU
[Raw transfer]




THP_A_2(4ZUJ)
NUC_STAAU
[Raw transfer]




THP_A_3(5IIF)
?
[Raw transfer]




THP_A_3(3D6C)
NUC_STAAU
[Raw transfer]




THP_A_2(3SR1)
NUC_STAAU
[Raw transfer]




THP_A_2(1JOQ)
NUC_STAAU
[Raw transfer]




THP_A_2(3NXW)
NUC_STAAU
[Raw transfer]




THP_A_3(5C4Z)
NUC_STAAU
[Raw transfer]




THP_C_11(3HEJ)
NUC_STAAU
[Raw transfer]




THP_A_3(4EQP)
NUC_STAAU
[Raw transfer]




THP_A_3(4F8M)
NUC_STAAU
[Raw transfer]




THP_A_3(3BDC)
NUC_STAAU
[Raw transfer]




THP_A_3(4DFA)
NUC_STAAU
[Raw transfer]




THP_A_3(2SNM)
NUC_STAAU
[Raw transfer]




THP_A_3(4HMJ)
NUC_STAAU
[Raw transfer]




THP_A_3(1STA)
NUC_STAAU
[Raw transfer]




THP_A_3(4ZQ3)
NUC_STAAU
[Raw transfer]




THP_A_3(1SNM)
NUC_STAAU
[Raw transfer]




THP_A_3(4QF4)
NUC_STAAU
[Raw transfer]




THP_A_3(1STY)
NUC_STAAU
[Raw transfer]




THP_A_3(1SYB)
NUC_STAAU
[Raw transfer]




THP_A_3(1STH)
NUC_STAAU
[Raw transfer]




THP_A_2(3ITP)
NUC_STAAU
[Raw transfer]




THP_A_2(4J6H)
NUC_STAAU
[Raw transfer]




THP_A_3(2SNS)
NUC_STAAU
[Raw transfer]




THP_A_2(4K5X)
NUC_STAAU
[Raw transfer]




THP_A_3(5I9P)
?
[Raw transfer]




THP_B_6(4QF4)
NUC_STAAU
[Raw transfer]




THP_A_2(4PNY)
NUC_STAAU
[Raw transfer]




THP_A_2(4K6D)
NUC_STAAU
[Raw transfer]




THP_D_8(3HEJ)
NUC_STAAU
[Raw transfer]




THP_A_3(4KD4)
NUC_STAAU
[Raw transfer]




THP_A_3(4WOR)
NUC_STAAU
[Raw transfer]




THP_A_3(4IUN)
NUC_STAAU
[Raw transfer]




THP_B_9(3HEJ)
NUC_STAAU
[Raw transfer]




THP_A_3(1STB)
NUC_STAAU
[Raw transfer]




THP_A_2(3LX0)
NUC_STAAU
[Raw transfer]




THP_A_2(3MVV)
NUC_STAAW
[Raw transfer]




THP_A_2(2ENB)
NUC_STAAU
[Raw transfer]




THP_B_2(2OXP)
NUC_STAAW
[Raw transfer]




MRD_A_7(3T13)
NUC_STAAU
[Raw transfer]




MRD_B_10(3T13)
NUC_STAAU
[Raw transfer]




THP_A_5(3HEJ)
NUC_STAAU
[Raw transfer]




MPD_A_3(3DMU)
NUC_STAAU
[Raw transfer]




THP_A_3(1A2T)
NUC_STAAU
[Raw transfer]




MPD_A_5(4IUN)
NUC_STAAU
[Raw transfer]




151 Fugue 71.9847% 15 - C9 -1JOR - NUC_STAAU -
58 PsiBlast_CBE 69.7750% 27 - C9 -5EKL 6.7 NUC_STAAU
37 PsiBlast_CBE 69.2653% 32 - C9 -2SNM 6.1 NUC_STAAU
30 PsiBlast_CBE 69.2354% 18 - C9 -1JOK 5.0 NUC_STAAU
45 PsiBlast_CBE 68.4252% 34 - C9 -2PZT - NUC_STAAW -
8 PsiBlast_PDB 68.1854% 29 - C9 -4K5X 6.8 NUC_STAAU
51 PsiBlast_CBE 68.0750% 2 - C9 -3U9O - NUC_STAAU -
79 PsiBlast_CBE 67.7050% 14 - C9 -5DEH 6.8 NUC_STAAU
2 PsiBlast_PDB 67.6054% 34 - C9 -1KDA - NUC_STAAU -
38 PsiBlast_CBE 67.5753% 34 - C9 -1SYF 6.4 NUC_STAAU
32 PsiBlast_CBE 67.5654% 20 - C9 -4K5W 6.5 NUC_STAAU
41 PsiBlast_CBE 67.4853% 38 - C9 -1STY 7.0 NUC_STAAU
26 PsiBlast_CBE 67.4254% 30 - C9 -4QF4 6.2 NUC_STAAU
22 PsiBlast_CBE 67.4054% 28 - C9 -4KD4 6.9 NUC_STAAU
33 PsiBlast_CBE 67.3253% 28 - C9 -1SNM 7.2 NUC_STAAU
94 PsiBlast_CBE 67.2950% 30 - C9 -5C5M 7.0 NUC_STAAU
27 PsiBlast_CBE 67.2854% 35 - C9 -4QF4 6.3 NUC_STAAU
48 PsiBlast_CBE 67.2452% 29 - C9 -2OXP 6.8 NUC_STAAW
31 PsiBlast_CBE 67.1953% 31 - C9 -1ENC 6.5 NUC_STAAU
21 PsiBlast_CBE 67.1954% 31 - C9 -4WOR 6.6 NUC_STAAU
18 PsiBlast_PDB 67.1953% 25 - C9 -4ODG 6.9 NUC_STAAU
100 PsiBlast_CBE 67.1250% 22 - C9 -4J6H 6.8 NUC_STAAU
76 PsiBlast_CBE 67.1050% 18 - C9 -4KV6 7.0 NUC_STAAU
12 PsiBlast_PDB 67.0252% 36 - C9 -1STA 7.0 NUC_STAAU
28 PsiBlast_CBE 66.8454% 14 - C9 -4K6D 7.1 NUC_STAAU
98 PsiBlast_CBE 66.8149% 14 * C9 *3NQT 6.8 NUC_STAAU
42 PsiBlast_CBE 66.7753% 50 - C9 -1STB 6.6 NUC_STAAU
35 PsiBlast_CBE 66.7254% 26 - C9 -2ENB 6.1 NUC_STAAU
17 PsiBlast_PDB 66.6555% 26 - C9 -4R8N 6.5 NUC_STAAU
39 PsiBlast_CBE 66.6453% 31 - C9 -1SYD 6.9 NUC_STAAU
24 PsiBlast_CBE 66.6254% 25 - C9 -1STG 6.8 NUC_STAAU
82 PsiBlast_CBE 66.4349% 14 - C9 -4DF7 6.9 NUC_STAAU
44 PsiBlast_CBE 66.3954% 31 - C9 -1A2T 2.3 NUC_STAAU
67 PsiBlast_CBE 66.3750% 14 - C9 -3BDC 7.1 NUC_STAAU
90 PsiBlast_CBE 66.3650% 22 - C9 -5C4Z 6.8 NUC_STAAU
25 PsiBlast_CBE 66.3554% 33 - C9 -1SNC 6.7 NUC_STAAU
84 PsiBlast_CBE 66.3350% 30 - C9 -3TP8 6.9 NUC_STAAU
29 PsiBlast_CBE 66.2954% 36 - C9 -1JOQ 4.7 NUC_STAAU
49 PsiBlast_CBE 66.2052% 38 - C9 -3D6C 6.6 NUC_STAAU
97 PsiBlast_CBE 66.1450% 23 - C9 -4DFA 6.8 NUC_STAAU
23 PsiBlast_CBE 66.1254% 29 - C9 -1STH 6.9 NUC_STAAU
86 PsiBlast_CBE 66.1050% 20 - C9 -3NXW 7.0 NUC_STAAU
87 PsiBlast_CBE 66.0350% 35 - C9 -5C6A 7.0 NUC_STAAU
95 PsiBlast_CBE 65.9150% 24 - C9 -3PMF 6.8 NUC_STAAU
99 PsiBlast_CBE 65.8550% 18 - C9 -4PNY 7.0 NUC_STAAU
70 PsiBlast_CBE 65.7950% 37 - C9 -3HEJ 6.6 NUC_STAAU
101 HHSearch 65.7649% 7 - C9 -4EQP 6.9 NUC_STAAU
85 PsiBlast_CBE 65.7350% 16 - C9 -3NK9 6.9 NUC_STAAU
57 PsiBlast_CBE 65.7351% 18 - C9 -4F8M 6.9 NUC_STAAU
72 PsiBlast_CBE 65.6250% 18 - C9 -4IZ8 6.9 NUC_STAAU
43 PsiBlast_CBE 65.6153% 25 - C9 -3DMU 3.6 NUC_STAAU
74 PsiBlast_CBE 65.5550% 16 - C9 -3MXP 6.9 NUC_STAAU
64 PsiBlast_CBE 65.5150% 21 - C9 -3S9W 7.0 NUC_STAAU
78 PsiBlast_CBE 65.5050% 21 - C9 -3OSO 6.8 NUC_STAAU
96 PsiBlast_CBE 65.3649% 24 - C9 -3LX0 6.8 NUC_STAAU
92 PsiBlast_CBE 65.3250% 21 - C9 -4ZQ3 6.9 NUC_STAAU
59 PsiBlast_CBE 65.3150% 18 - C9 -5I9P 6.9 ?
75 PsiBlast_CBE 65.2750% 26 - C9 -3NP8 6.8 NUC_STAAU
68 PsiBlast_CBE 65.2250% 38 - C9 -3HEJ 6.7 NUC_STAAU
71 PsiBlast_CBE 65.1750% 35 - C9 -3HEJ 6.2 NUC_STAAU
77 PsiBlast_CBE 65.1650% 21 - C9 -4KTA 7.1 NUC_STAAU
91 PsiBlast_CBE 65.0749% 16 - C9 -4ZUJ 7.0 NUC_STAAU
56 PsiBlast_CBE 65.0650% 21 - C9 -4LAA 6.9 NUC_STAAU
73 PsiBlast_CBE 65.0350% 23 - C9 -3R3O 6.8 NUC_STAAW
65 PsiBlast_CBE 64.9750% 21 - C9 -5IIF 7.1 ?
69 PsiBlast_CBE 64.9650% 35 - C9 -3HEJ 6.3 NUC_STAAU
61 PsiBlast_CBE 64.9650% 21 - C9 -3T13 3.3 NUC_STAAU
81 PsiBlast_CBE 64.9550% 23 - C9 -4IUN 6.4 NUC_STAAU
93 PsiBlast_CBE 64.8850% 23 - C9 -4HMJ 7.0 NUC_STAAU
40 PsiBlast_CBE 64.8253% 70 - C9 -1SYB 6.7 NUC_STAAU
62 PsiBlast_CBE 64.8150% 19 - C9 -3SR1 6.9 NUC_STAAU
66 PsiBlast_CBE 64.7950% 24 - C9 -3MVV 6.7 NUC_STAAW
80 PsiBlast_CBE 64.7550% 17 - C9 -4J1M 6.8 NUC_STAAU
89 PsiBlast_CBE 64.6050% 29 - C9 -3ITP 7.0 NUC_STAAU
60 PsiBlast_CBE 64.5150% 19 - C9 -3T13 2.6 NUC_STAAU
16 PsiBlast_PDB 63.9954% 20 - C9 -2SNS 5.2 NUC_STAAU
88 PsiBlast_CBE 62.8650% 16 - C9 -3MEH 7.2 NUC_STAAU