@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu21810: (2016-07-03 )
MISFIFAMDANRLIGKDNDLPWHLPNDLAYFKKITSGHSIIMGRKTFESIGRPLPNRKNIVVTSAPDSEFQGCTVVSSLKDVLDICSGPEECFVIGGAQLYTDLFPYADRLYMTKIHHEFEGDRHFPEFDESNWKLVSSEQGTKDEKNPYDYEFLMYEKKNSSKAGGF

Atome Classification :

(76 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

6DR_A_4(3SA1)
?
[Raw transfer]




5DR_B_6(3S9U)
?
[Raw transfer]




9DR_A_4(3SAI)
?
[Raw transfer]




9DR_B_10(3SAI)
?
[Raw transfer]




5DR_A_4(3S9U)
?
[Raw transfer]




7DR_B_6(3SA2)
?
[Raw transfer]




7DR_A_4(3SA2)
?
[Raw transfer]




MTX_A_6(4DFR)
DYR_ECOLI
[Raw transfer]




EKB_A_4(3JVX)
?
[Raw transfer]




6DR_B_6(3SA1)
?
[Raw transfer]




EKB_B_6(3JVX)
?
[Raw transfer]




TOP_A_3(2W9H)
DYR_STAAU
[Raw transfer]




5WB_A_4(3JWK)
?
[Raw transfer]




MTX_A_6(3IA4)
?
[Raw transfer]




N22_B_6(3E0B)
?
[Raw transfer]




GOL_H_8(1ZDR)
?
[Raw transfer]




MTX_A_2(3DAT)
?
[Raw transfer]




5WA_B_6(3JWF)
?
[Raw transfer]




N22_A_4(3E0B)
?
[Raw transfer]




5WA_A_4(3JWF)
?
[Raw transfer]




LII_A_3(1KMV)
DYR_HUMAN
[Raw transfer]




5WB_A_4(3JWM)
?
[Raw transfer]




GW3_A_4(1AOE)
DYR_CANAX
[Raw transfer]




MTX_A_2(2QK8)
?
[Raw transfer]




06U_A_6(4OSG)
?
[Raw transfer]




06U_D_19(4OSG)
?
[Raw transfer]




N22_A_5(3CSE)
?
[Raw transfer]




NAP_B_8(4OSG)
?
[Raw transfer]




NAP_D_18(4OSG)
?
[Raw transfer]




NDP_D_11(3IA4)
?
[Raw transfer]




NAP_A_5(4OSG)
?
[Raw transfer]




NDP_A_2(3TQ9)
?
[Raw transfer]




NAP_A_3(3JW5)
?
[Raw transfer]




NAP_C_12(4OSG)
?
[Raw transfer]




NAP_A_2(2KGK)
?
[Raw transfer]




NAP_A_3(3JWC)
?
[Raw transfer]




NAP_B_5(3JWF)
?
[Raw transfer]




NAP_B_5(3SA1)
?
[Raw transfer]




NAP_B_5(3JWK)
?
[Raw transfer]




NAP_A_3(3JW3)
?
[Raw transfer]




NAP_B_4(3LG4)
DYR_STAAU
[Raw transfer]




NDP_A_2(3TQ8)
?
[Raw transfer]




NAP_B_5(3JWM)
?
[Raw transfer]




NDP_A_2(3TQ8)
?
[Raw transfer]




NAP_A_3(3LG4)
DYR_STAAU
[Raw transfer]




NAP_A_3(3SAI)
?
[Raw transfer]




NDP_A_2(3TQB)
?
[Raw transfer]




NAP_B_5(3E0B)
?
[Raw transfer]




NAP_B_5(3SA2)
?
[Raw transfer]




NDP_A_5(3IA4)
?
[Raw transfer]




NDP_B_7(3IA4)
?
[Raw transfer]




NAP_A_3(2ZZA)
?
[Raw transfer]




NAP_A_3(3SA2)
?
[Raw transfer]




NAP_X_3(3NZB)
DYR_PNECA
[Raw transfer]




NAP_A_3(3SA1)
?
[Raw transfer]




NAP_A_3(3E0B)
?
[Raw transfer]




NDP_A_2(3TQA)
?
[Raw transfer]




NDP_C_9(3IA4)
?
[Raw transfer]




NAP_A_3(3JVX)
?
[Raw transfer]




NAP_A_3(3S9U)
?
[Raw transfer]




NAP_B_5(3JWC)
?
[Raw transfer]




NAP_B_5(3JW5)
?
[Raw transfer]




NAP_A_3(3S9U)
?
[Raw transfer]




NAP_B_5(3JVX)
?
[Raw transfer]




NAP_B_9(3SAI)
?
[Raw transfer]




NAP_B_6(2ZZA)
?
[Raw transfer]




NAP_A_3(3JWM)
?
[Raw transfer]




NAP_B_5(3JW3)
?
[Raw transfer]




NAP_A_3(3JWK)
?
[Raw transfer]




NAP_A_3(3JWF)
?
[Raw transfer]




NAP_B_5(3S9U)
?
[Raw transfer]




NAP_A_3(3DAT)
?
[Raw transfer]




ATR_A_3(4KLX)
DYR_MYCTU
[Raw transfer]




NAP_A_2(4M7U)
?
[Raw transfer]




CP6_A_3(2BL9)
DRTS_PLAVI
[Raw transfer]




44 PsiBlast_CBE 94.0955%-159 - C4 -4ELE - ? -
9 PsiBlast_PDB 93.2355%-152 - C4 -4ELF - ? -
29 PsiBlast_CBE 93.2255%-160 - C4 -4ELG - ? -
30 PsiBlast_CBE 92.9755%-156 - C4 -4ELG - ? -
50 PsiBlast_CBE 92.9355%-156 - C4 -4ELB - ? -
31 PsiBlast_CBE 92.9155%-157 - C4 -4ELG - ? -
10 PsiBlast_PDB 92.7955%-158 - C4 -4ELG - ? -
45 PsiBlast_CBE 92.7855%-157 - C4 -4ELE - ? -
7 PsiBlast_PDB 92.4255%-149 - C4 -4ELB - ? -
23 PsiBlast_CBE 92.4155%-151 - C4 -4ELH - ? -
43 PsiBlast_CBE 92.3055%-163 - C4 -4ELE - ? -
22 PsiBlast_CBE 92.2855%-152 - C4 -4ELH - ? -
39 PsiBlast_CBE 92.2655%-154 - C4 -4ELF - ? -
67 PsiBlast_CBE 92.2555%-153 - C4 -3FL8 - ? -
36 PsiBlast_CBE 92.1755%-152 - C4 -4ELF - ? -
34 PsiBlast_CBE 92.1655%-154 - C4 -4ELG - ? -
33 PsiBlast_CBE 92.1655%-156 - C4 -4ELG - ? -
28 PsiBlast_CBE 92.1455%-147 - C4 -4ELH - ? -
24 PsiBlast_CBE 92.1355%-154 - C4 -4ELH - ? -
41 PsiBlast_CBE 92.0655%-150 - C4 -4ELF - ? -
15 PsiBlast_PDB 91.0655%-152 - C4 -3SA1 12.7 ?
78 PsiBlast_CBE 90.9455%-149 - C4 -3JWK 12.9 ?
12 PsiBlast_PDB 90.8855%-155 - C4 -3JVX 12.9 ?
80 PsiBlast_CBE 90.8655%-156 - C4 -3JWF 13.0 ?
17 PsiBlast_PDB 90.4255%-154 - C4 -3SAI 13.1 ?
74 PsiBlast_CBE 90.4155%-152 - C4 -3SA1 12.5 ?
14 PsiBlast_PDB 90.2755%-154 - C4 -3S9U 13.1 ?
75 PsiBlast_CBE 90.2055%-152 - C4 -3S9U 13.0 ?
21 PsiBlast_CBE 90.1956%-153 - C4 -3JW3 12.4 ?
20 PsiBlast_PDB 90.1855%-158 - C4 -3JWC 13.0 ?
72 PsiBlast_CBE 90.1555%-154 - C4 -3SAI 12.8 ?
19 PsiBlast_PDB 89.6755%-145 - C4 -3JW5 12.7 ?
73 PsiBlast_CBE 89.4855%-156 - C4 -3SA2 12.8 ?
16 PsiBlast_PDB 89.4555%-155 - C4 -3SA2 12.8 ?
76 PsiBlast_CBE 89.1055%-151 - C4 -3E0B 12.7 ?
113 HHSearch 89.0947%-142 - C4 -3TQ8 12.4 ?
18 PsiBlast_PDB 89.0755%-154 - C4 -3E0B 13.1 ?
3 PsiBlast_PDB 89.0355%-145 - C4 -2QK8 8.5 ?
116 HHSearch 88.9954%-138 * C4 *3S9U 13.1 ?
77 PsiBlast_CBE 88.8055%-150 - C4 -3JWK 12.5 ?
4 PsiBlast_PDB 88.7855%-148 - C4 -3DAT 10.0 ?
79 PsiBlast_CBE 88.6555%-154 - C4 -3JWF 12.8 ?
81 PsiBlast_CBE 88.6055%-153 - C4 -3JWC 12.6 ?
71 PsiBlast_CBE 88.5855%-149 - C4 -3JVX 12.6 ?
82 PsiBlast_CBE 88.4955%-147 - C4 -3JW5 12.4 ?
1 PsiBlast_PDB 88.0756%-152 - C4 -3JW3 12.3 ?
93 PsiBlast_CBE 87.8645%-155 - C4 -3IA4 10.0 ?
13 PsiBlast_PDB 87.2755%-151 - C4 -3JWM 12.8 ?
94 PsiBlast_CBE 87.2245%-160 - C4 -3IA4 10.8 ?
91 PsiBlast_CBE 86.9845%-157 - C4 -3IA4 10.1 ?
70 PsiBlast_CBE 86.9355%-152 - C4 -3JWM 12.4 ?
92 PsiBlast_CBE 86.7245%-156 - C4 -3IA4 10.9 ?
96 PsiBlast_CBE 86.2245%-156 - C4 -2ZZA 9.9 ?
95 PsiBlast_CBE 86.1145%-154 - C4 -2ZZA 9.2 ?
86 PsiBlast_CBE 85.7949%-177 - C4 -3TQA 11.7 ?
88 PsiBlast_CBE 85.6449%-177 - C4 -3TQ8 12.4 ?
83 PsiBlast_CBE 85.6255%-101 - C4 -1ZDR 2.5 ?
87 PsiBlast_CBE 84.1549%-191 - C4 -3TQ9 12.1 ?
85 PsiBlast_CBE 84.1249%-197 - C4 -3TQB 11.5 ?
98 PsiBlast_CBE 83.8343%-156 - C4 -3LG4 12.0 DYR_STAAU
102 PsiBlast_CBE 83.6345%-150 - C4 -4OSG 8.2 ?
97 PsiBlast_CBE 83.5043%-157 - C4 -3LG4 12.3 DYR_STAAU
99 PsiBlast_CBE 82.5445%-139 - C4 -4OSG 8.1 ?
100 PsiBlast_CBE 82.4845%-147 - C4 -4OSG 9.3 ?
117 HHSearch 82.4042%-142 - C4 -2W9H 4.9 DYR_STAAU
101 PsiBlast_CBE 80.3345%-144 - C4 -4OSG 7.2 ?
114 HHSearch 77.1843% -41 - C4 -4M7U 8.5 ?
2 PsiBlast_PDB 77.0855%-117 - C4 -2KGK 8.9 ?
126 HHSearch 75.0144% -50 - C4 -3IA4 9.0 ?
103 Fugue 73.4944% -41 - C4 -4DFR 8.3 DYR_ECOLI
119 HHSearch 70.5338% -46 - C4 -4KLX 8.5 DYR_MYCTU
129 HHSearch 65.8136% 7 - C4 -3NZB 10.4 DYR_PNECA
125 HHSearch 64.3035% 35 - C4 -1KMV 5.7 DYR_HUMAN
133 HHSearch 60.4631% 15 - C4 -3CSE 4.1 ?
127 HHSearch 59.1930% 20 - C4 -1AOE 4.0 DYR_CANAX
120 HHSearch 54.2332% 51 - C4 -2BL9 3.6 DRTS_PLAVI