@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu21820: (2016-07-03 )
MTQFDKQYNSIIKDIINNGISDEEFDVRTKWDSDGTPAHTLSVMSKQMRFDNSEVPILTTKKVAWKTAIKELLWIWQLKSNDVNDLNKMGVHIWDQWKQEDGTIGHAYGFQLGKKNRSLNGEKVDQVDYLLHQLKNNPSSRRHITMLWNPDDLDAMSLTPCVYETQWYVKHGKLHLEVRARSNDMALGNPFNVFQYNVLQRMIAQVTGYELGEYIFNIGDCHVYTRHIDNLKIQMEREQFEAPELWINPEVKDFYNFTIDDFKLINYKHGDKLLFEVAV

Atome Classification :

(61 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

UMP_A_3(4DQ1)
TYSY_STAAM
[Raw transfer]




UMP_B_11(5BY6)
?
[Raw transfer]




UMP_E_5(1F28)
TYSY_PNECA
[Raw transfer]




UMP_A_5(3UM6)
?
[Raw transfer]




NOH_B_4(4EIN)
TYSY_MOUSE
[Raw transfer]




UMP_B_8(3UM5)
?
[Raw transfer]




UMP_A_5(3QG2)
?
[Raw transfer]




C2F_A_3(1B02)
TYSY1_BACSU
[Raw transfer]




UMP_D_14(5BY6)
?
[Raw transfer]




DHF_A_3(4EZ8)
TYSY_MOUSE
[Raw transfer]




BVP_A_5(4XSC)
TYSY_VZVO
[Raw transfer]




UMP_A_5(5BY6)
?
[Raw transfer]




UMP_C_7(1J3K)
?
[Raw transfer]




UMP_C_12(5BY6)
?
[Raw transfer]




LYA_H_8(1JUJ)
TYSY_HUMAN
[Raw transfer]




UMP_B_8(3UM6)
?
[Raw transfer]




DHF_A_3(4EZ8)
TYSY_MOUSE
[Raw transfer]




LYA_K_11(1JU6)
TYSY_HUMAN
[Raw transfer]




LYA_J_10(1JUJ)
TYSY_HUMAN
[Raw transfer]




LYA_L_12(1JUJ)
TYSY_HUMAN
[Raw transfer]




LYA_F_6(1JUJ)
TYSY_HUMAN
[Raw transfer]




LYA_M_13(1JU6)
TYSY_HUMAN
[Raw transfer]




LYA_G_7(1JU6)
TYSY_HUMAN
[Raw transfer]




LYA_I_9(1JU6)
TYSY_HUMAN
[Raw transfer]




D16_A_6(4EB4)
TYSY_MOUSE
[Raw transfer]




D16_B_6(1I00)
TYSY_HUMAN
[Raw transfer]




D16_H_8(1HVY)
TYSY_HUMAN
[Raw transfer]




D16_J_10(2TSR)
TYSY_RAT
[Raw transfer]




D16_F_6(1HVY)
TYSY_HUMAN
[Raw transfer]




D16_G_7(1HVY)
TYSY_HUMAN
[Raw transfer]




GOL_B_5(4EIN)
TYSY_MOUSE
[Raw transfer]




D16_A_5(1I00)
TYSY_HUMAN
[Raw transfer]




D16_F_6(1RTS)
TYSY_RAT
[Raw transfer]




LYA_A_4(4FQS)
TYSY_MYCTU
[Raw transfer]




GOL_D_17(5BY6)
?
[Raw transfer]




D16_E_5(1HVY)
TYSY_HUMAN
[Raw transfer]




D16_I_9(2TSR)
TYSY_RAT
[Raw transfer]




D16_K_11(2TSR)
TYSY_RAT
[Raw transfer]




D16_E_5(1RTS)
TYSY_RAT
[Raw transfer]




D16_L_12(2TSR)
TYSY_RAT
[Raw transfer]




CIT_A_5(3V8H)
?
[Raw transfer]




DTT_A_6(5BY6)
?
[Raw transfer]




1PE_A_6(4XSC)
TYSY_VZVO
[Raw transfer]




UFP_D_8(3EJL)
TYSY_HUMAN
[Raw transfer]




BME_A_5(2RD8)
TYSY_HUMAN
[Raw transfer]




EDO_B_24(3NRR)
?
[Raw transfer]




3 PsiBlast_PDB 99.4898% -92 - C- -1BKP - TYSY1_BACSU -
2 PsiBlast_PDB 98.9298% -89 - C8 -1BKO - TYSY1_BACSU -
21 PsiBlast_CBE 98.4798% -90 - C8 -1BSP - TYSY1_BACSU -
1 PsiBlast_PDB 98.3098% -86 - C8 -1B02 5.6 TYSY1_BACSU
5 PsiBlast_PDB 96.9098% -89 - C8 -1BSP - TYSY1_BACSU -
4 PsiBlast_PDB 96.7398% -87 - C8 -1BSF - TYSY1_BACSU -
101 HHSearch 78.3096% 13 - C- -1BKP - TYSY1_BACSU -
122 Fugue 76.3498% 1 - C- -1BKP - TYSY1_BACSU -
88 PsiBlast_CBE 67.9136% 5 - C8 -4H1I - TYSY_HUMAN -
59 PsiBlast_CBE 67.6136% 4 - C8 -3HB8 - TYSY_HUMAN -
54 PsiBlast_CBE 67.6036% 5 - C8 -3OB7 - TYSY_HUMAN -
57 PsiBlast_CBE 67.5936% 6 - C8 -3HB8 - TYSY_HUMAN -
53 PsiBlast_CBE 67.5336% 6 - C8 -3OB7 - TYSY_HUMAN -
43 PsiBlast_CBE 67.4736% 3 - C8 -3EJL - TYSY_HUMAN -
58 PsiBlast_CBE 67.3736% 6 - C8 -3HB8 - TYSY_HUMAN -
69 PsiBlast_CBE 67.3136% 8 - C8 -2RDA - TYSY_HUMAN -
82 PsiBlast_CBE 67.3036% 4 - C8 -5HS3 - ? -
62 PsiBlast_CBE 67.1736% 5 - C8 -3H9K - TYSY_HUMAN -
87 PsiBlast_CBE 67.1436% 8 - C8 -4H1I - TYSY_HUMAN -
68 PsiBlast_CBE 67.0836% 7 - C8 -2RDA - TYSY_HUMAN -
36 PsiBlast_CBE 66.9036% 4 - C8 -1JU6 5.8 TYSY_HUMAN
71 PsiBlast_CBE 66.8236% 5 - C8 -2RD8 1.9 TYSY_HUMAN
20 PsiBlast_PDB 66.7236% 4 - C8 -1I00 4.4 TYSY_HUMAN
35 PsiBlast_CBE 66.5536% 5 - C8 -1JU6 6.1 TYSY_HUMAN
41 PsiBlast_CBE 66.5036% 2 - C8 -3EJL 3.9 TYSY_HUMAN
37 PsiBlast_CBE 66.3636% 5 - C8 -1JU6 6.4 TYSY_HUMAN
11 PsiBlast_PDB 65.8236% 5 - C8 -1JU6 6.4 TYSY_HUMAN
33 PsiBlast_CBE 65.5736% 9 - C8 -1JUJ 6.3 TYSY_HUMAN
32 PsiBlast_CBE 65.4936% 9 - C8 -1JUJ 6.1 TYSY_HUMAN
9 PsiBlast_PDB 65.4335% 6 - C8 -4EB4 6.0 TYSY_MOUSE
98 PsiBlast_CBE 65.3836% -19 - C8 -3UM6 4.0 ?
34 PsiBlast_CBE 65.3236% 9 - C8 -1JUJ 6.0 TYSY_HUMAN
22 PsiBlast_CBE 65.2435% 10 - C8 -4EIN 3.9 TYSY_MOUSE
95 PsiBlast_CBE 65.2236% 18 - C8 -5BY6 4.5 ?
12 PsiBlast_PDB 65.2236% 9 - C8 -1JUJ 6.1 TYSY_HUMAN
44 PsiBlast_CBE 65.1636% 11 - C8 -1I00 4.7 TYSY_HUMAN
76 PsiBlast_CBE 65.1035% 10 - C8 -1RTS 4.8 TYSY_RAT
99 PsiBlast_CBE 65.0636% -14 - C8 -3UM6 4.3 ?
10 PsiBlast_PDB 64.9135% 8 - C8 -4EZ8 5.9 TYSY_MOUSE
100 PsiBlast_CBE 64.7936% -16 - C8 -3UM5 4.3 ?
74 PsiBlast_CBE 64.5335% 10 - C8 -2TSR 5.0 TYSY_RAT
73 PsiBlast_CBE 64.4035% 11 - C8 -2TSR 4.7 TYSY_RAT
75 PsiBlast_CBE 64.2235% 11 - C8 -2TSR 4.6 TYSY_RAT
77 PsiBlast_CBE 64.1435% 10 - C8 -1RTS 4.8 TYSY_RAT
96 PsiBlast_CBE 63.9836% 25 - C8 -5BY6 4.6 ?
113 HHSearch 63.8931% -7 - C8 -3V8H 3.2 ?
121 HHSearch 63.7636% -19 - C8 -3NRR 3.0 ?
94 PsiBlast_CBE 63.7236% 21 - C8 -5BY6 4.5 ?
91 PsiBlast_CBE 63.3837% 11 - C8 -1HVY 5.6 TYSY_HUMAN
93 PsiBlast_CBE 63.3637% 9 - C8 -1HVY 5.2 TYSY_HUMAN
97 PsiBlast_CBE 63.3036% 25 - C8 -5BY6 4.5 ?
110 HHSearch 63.1839% -10 - C8 -1J3K 4.6 ?
72 PsiBlast_CBE 63.0935% 9 - C8 -2TSR 3.7 TYSY_RAT
108 HHSearch 63.0235% 5 - C8 -1F28 3.6 TYSY_PNECA
114 HHSearch 62.9935% -25 - C8 -4FQS 5.8 TYSY_MYCTU
92 PsiBlast_CBE 62.8737% 8 - C8 -1HVY 5.9 TYSY_HUMAN
119 HHSearch 62.8239% -9 - C8 -3QG2 4.7 ?
103 HHSearch 62.3838% 3 - C8 -4EZ8 5.9 TYSY_MOUSE
90 PsiBlast_CBE 61.8337% 13 - C8 -1HVY 6.2 TYSY_HUMAN
116 HHSearch 59.8238% -11 - C8 -4XSC 4.7 TYSY_VZVO
104 HHSearch 58.3737% 12 - C8 -4DQ1 4.1 TYSY_STAAM