Study : bsu22420 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C4_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C4_S1
Complex: GOL_A_5(3MUE) / Model_13(3MUE/A) = [3.1] Download537.9749.85MRQITDISQLKEAIKQYHSEGKSIGFVPTMGFLHEGHLTLADKARQENDAVIMSIFVNPAQFGPNEDFEAYPRDIERDAALAENAGVDILFTPDAHDMYPGEKNVTIHVERRTDVLCGRSREGHFDGVAIVLTKLFNLVKPTRAYFGLKDAQQVAVVDGLISDFFMDIELVPVDTVREEDGLAKSSRNVYLTAEERKEAPKLYRALQTSAELVQAGERDPEAVIKAAKDIIETTSGTIDYVELYSYPELEPVNEIAGKMILAVAVAFSKARLIDNIIIDIREMERI
Complex: GOL_A_6(1UFV) / Model_9(1UFV/A) = [3.2] Download533.6029.67MRQITDISQLKEAIKQYHSEGKSIGFVPTMGFLHEGHLTLADKARQENDAVIMSIFVNPAQFGPNEDFEAYPRDIERDAALAENAGVDILFTPDAHDMYPGEKNVTIHVERRTDVLCGRSREGHFDGVAIVLTKLFNLVKPTRAYFGLKDAQQVAVVDGLISDFFMDIELVPVDTVREEDGLAKSSRNVYLTAEERKEAPKLYRALQTSAELVQAGERDPEAVIKAAKDIIETTSGTIDYVELYSYPELEPVNEIAGKMILAVAVAFSKARLIDNIIIDIREMERI
Complex: 0OC_A_3(4EFK) / Model_56(4EFK/A) = [3.2] Download453.6044.35MRQITDISQLKEAIKQYHSEGKSIGFVPTMGFLHEGHLTLADKARQENDAVIMSIFVNPAQFGPNEDFEAYPRDIERDAALAENAGVDILFTPDAHDMYPGEKNVTIHVERRTDVLCGRSREGHFDGVAIVLTKLFNLVKPTRAYFGLKDAQQVAVVDGLISDFFMDIELVPVDTVREEDGLAKSSRNVYLTAEERKEAPKLYRALQTSAELVQAGERDPEAVIKAAKDIIETTSGTIDYVELYSYPELEPVNEIAGKMILAVAVAFSKARLIDNIIIDIREMERI
Complex: BAL_F_6(1N2O) / Model_69(1N2O/A) = [3.3] Download357.8053.47MRQITDISQLKEAIKQYHSEGKSIGFVPTMGFLHEGHLTLADKARQENDAVIMSIFVNPAQFGPNEDFEAYPRDIERDAALAENAGVDILFTPDAHDMYPGEKNVTIHVERRTDVLCGRSREGHFDGVAIVLTKLFNLVKPTRAYFGLKDAQQVAVVDGLISDFFMDIELVPVDTVREEDGLAKSSRNVYLTAEERKEAPKLYRALQTSAELVQAGERDPEAVIKAAKDIIETTSGTIDYVELYSYPELEPVNEIAGKMILAVAVAFSKARLIDNIIIDIREMERI
Complex: GOL_C_22(3MUE) / Model_34(3MUE/C) = [3.3] Download409.1139.42MRQITDISQLKEAIKQYHSEGKSIGFVPTMGFLHEGHLTLADKARQENDAVIMSIFVNPAQFGPNEDFEAYPRDIERDAALAENAGVDILFTPDAHDMYPGEKNVTIHVERRTDVLCGRSREGHFDGVAIVLTKLFNLVKPTRAYFGLKDAQQVAVVDGLISDFFMDIELVPVDTVREEDGLAKSSRNVYLTAEERKEAPKLYRALQTSAELVQAGERDPEAVIKAAKDIIETTSGTIDYVELYSYPELEPVNEIAGKMILAVAVAFSKARLIDNIIIDIREMERI
Consensus
[pKd Mean = 3.22]
-458
(s=70)
43
(s=8)
MRQITDISQLKEAIKQYHSEGKSIGFVPTMGFLHEGHLTLADKARQENDAVIMSIFVNPAQFGPNEDFEAYPRDIERDAALAENAGVDILFTPDAHDMYPGEKNVTIHVERRTDVLCGRSREGHFDGVAIVLTKLFNLVKPTRAYFGLKDAQQVAVVDGLISDFFMDIELVPVDTVREEDGLAKSSRNVYLTAEERKEAPKLYRALQTSAELVQAGERDPEAVIKAAKDIIETTSGTIDYVELYSYPELEPVNEIAGKMILAVAVAFSKARLIDNIIIDIREMERI