@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22420: (2016-07-04 )
MRQITDISQLKEAIKQYHSEGKSIGFVPTMGFLHEGHLTLADKARQENDAVIMSIFVNPAQFGPNEDFEAYPRDIERDAALAENAGVDILFTPDAHDMYPGEKNVTIHVERRTDVLCGRSREGHFDGVAIVLTKLFNLVKPTRAYFGLKDAQQVAVVDGLISDFFMDIELVPVDTVREEDGLAKSSRNVYLTAEERKEAPKLYRALQTSAELVQAGERDPEAVIKAAKDIIETTSGTIDYVELYSYPELEPVNEIAGKMILAVAVAFSKARLIDNIIIDIREMERI

Atome Classification :

(105 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PAJ_B_9(3AG6)
PANC_STAA8
[Raw transfer]




PAJ_A_7(1N2H)
PANC_MYCTU
[Raw transfer]




PAJ_A_3(3AG6)
PANC_STAA8
[Raw transfer]




PAJ_B_7(1N2I)
PANC_MYCTU
[Raw transfer]




PAJ_A_3(3AG6)
PANC_STAA8
[Raw transfer]




ATP_C_9(3INN)
PANC_BRUME
[Raw transfer]




PAJ_A_6(1N2I)
PANC_MYCTU
[Raw transfer]




PAJ_B_8(1N2H)
PANC_MYCTU
[Raw transfer]




ATP_D_13(3INN)
PANC_BRUME
[Raw transfer]




ATP_A_5(3INN)
PANC_BRUME
[Raw transfer]




ATP_A_5(3INN)
PANC_BRUME
[Raw transfer]




APC_B_5(2X3F)
PANC_STAAR
[Raw transfer]




APC_A_7(1N2G)
PANC_MYCTU
[Raw transfer]




ATP_B_9(4G5Y)
PANC_MYCTU
[Raw transfer]




ATP_A_3(4G5Y)
PANC_MYCTU
[Raw transfer]




APC_A_6(1N2E)
PANC_MYCTU
[Raw transfer]




APC_B_8(1N2G)
PANC_MYCTU
[Raw transfer]




APC_B_7(1N2E)
PANC_MYCTU
[Raw transfer]




ATP_A_4(2A84)
PANC_MYCTU
[Raw transfer]




APC_A_6(1N2B)
PANC_MYCTU
[Raw transfer]




APC_A_3(2X3F)
PANC_STAAR
[Raw transfer]




AMP_B_5(2A86)
PANC_MYCTU
[Raw transfer]




APC_B_7(1N2B)
PANC_MYCTU
[Raw transfer]




AMP_A_5(3Q10)
PANC_YERPE
[Raw transfer]




2B5_A_3(3LE8)
PANC_MYCTU
[Raw transfer]




PAF_C_8(3Q12)
PANC_YERPE
[Raw transfer]




AMP_B_9(3Q10)
PANC_YERPE
[Raw transfer]




AMP_C_12(3Q10)
PANC_YERPE
[Raw transfer]




AMP_A_3(3UK2)
PANC_BURTA
[Raw transfer]




AMP_A_3(3UK2)
PANC_BURTA
[Raw transfer]




AMP_A_2(3UY4)
PANC_CAMJE
[Raw transfer]




PAF_B_7(3Q12)
PANC_YERPE
[Raw transfer]




AMP_A_4(2A86)
PANC_MYCTU
[Raw transfer]




PAF_G_7(1N2J)
PANC_MYCTU
[Raw transfer]




PAF_A_5(3Q12)
PANC_YERPE
[Raw transfer]




PAF_A_5(3Q12)
PANC_YERPE
[Raw transfer]




GOL_A_6(3MXT)
PANC_CAMJE
[Raw transfer]




FMT_A_5(3MXT)
PANC_CAMJE
[Raw transfer]




GOL_A_5(3MUE)
PANC_SALTY
[Raw transfer]




PAF_F_6(1N2J)
PANC_MYCTU
[Raw transfer]




AMP_A_3(2A7X)
PANC_MYCTU
[Raw transfer]




GOL_A_9(1UFV)
PANC_THET8
[Raw transfer]




GOL_A_3(3IVG)
PANC_MYCTU
[Raw transfer]




PAF_D_10(3Q12)
PANC_YERPE
[Raw transfer]




GOL_B_14(3MUE)
PANC_SALTY
[Raw transfer]




GOL_B_10(1V8F)
PANC_THET8
[Raw transfer]




GOL_A_6(3MXT)
PANC_CAMJE
[Raw transfer]




GOL_C_22(3MUE)
PANC_SALTY
[Raw transfer]




AMP_B_10(3UK2)
PANC_BURTA
[Raw transfer]




GOL_B_7(1MOP)
PANC_MYCTU
[Raw transfer]




GOL_A_9(1MOP)
PANC_MYCTU
[Raw transfer]




AMP_A_5(3N8H)
PANC_FRATT
[Raw transfer]




GOL_A_7(3COV)
PANC_MYCTU
[Raw transfer]




GOL_A_6(1UFV)
PANC_THET8
[Raw transfer]




FMT_A_9(3MXT)
PANC_CAMJE
[Raw transfer]




2DQ_A_7(4MUI)
PANC_MYCTO
[Raw transfer]




AMP_D_14(3Q10)
PANC_YERPE
[Raw transfer]




EDO_A_4(1IHO)
PANC_ECOLI
[Raw transfer]




2DJ_A_5(4MUF)
PANC_MYCTO
[Raw transfer]




EDO_A_4(1IHO)
PANC_ECOLI
[Raw transfer]




EDO_A_9(4FZJ)
PANC_MYCTU
[Raw transfer]




2DQ_B_10(4MUI)
PANC_MYCTO
[Raw transfer]




EDO_B_5(1IHO)
PANC_ECOLI
[Raw transfer]




2DU_A_6(4MUJ)
PANC_MYCTO
[Raw transfer]




29W_A_6(4MQ6)
PANC_MYCTO
[Raw transfer]




2DN_B_11(4MUH)
PANC_MYCTO
[Raw transfer]




FG6_A_3(3IVX)
PANC_MYCTU
[Raw transfer]




2DV_A_3(4MUK)
PANC_MYCTO
[Raw transfer]




FG6_B_14(3IVX)
PANC_MYCTU
[Raw transfer]




2DU_B_11(4MUJ)
PANC_MYCTO
[Raw transfer]




2DW_B_13(4MUL)
PANC_MYCTO
[Raw transfer]




2DW_A_6(4MUL)
PANC_MYCTO
[Raw transfer]




2DN_A_5(4MUH)
PANC_MYCTO
[Raw transfer]




FG5_B_16(3IVG)
PANC_MYCTU
[Raw transfer]




29W_B_14(4MQ6)
PANC_MYCTO
[Raw transfer]




2DK_A_7(4MUG)
PANC_MYCTO
[Raw transfer]




15N_B_10(4G5F)
PANC_MYCTU
[Raw transfer]




2DJ_B_6(4MUF)
PANC_MYCTO
[Raw transfer]




0JD_B_8(4DE5)
PANC_MYCTU
[Raw transfer]




0JD_A_4(4G5F)
PANC_MYCTU
[Raw transfer]




144_A_8(1V8F)
PANC_THET8
[Raw transfer]




0JD_A_3(4DE5)
PANC_MYCTU
[Raw transfer]




2DK_B_11(4MUG)
PANC_MYCTO
[Raw transfer]




2DZ_B_15(4MUN)
PANC_MYCTO
[Raw transfer]




2B5_B_11(3LE8)
PANC_MYCTU
[Raw transfer]




2DV_B_12(4MUK)
PANC_MYCTO
[Raw transfer]




144_A_8(1V8F)
PANC_THET8
[Raw transfer]




A8D_A_10(3ISJ)
PANC_MYCTU
[Raw transfer]




2DZ_A_7(4MUN)
PANC_MYCTO
[Raw transfer]




2DH_B_7(4MUE)
PANC_MYCTO
[Raw transfer]




A8D_B_15(3ISJ)
PANC_MYCTU
[Raw transfer]




2DH_A_3(4MUE)
PANC_MYCTO
[Raw transfer]




BAL_E_5(1N2O)
PANC_MYCTU
[Raw transfer]




0W1_B_12(4FZJ)
PANC_MYCTU
[Raw transfer]




0HO_A_8(4DDM)
PANC_MYCTU
[Raw transfer]




0HN_B_7(4DDK)
PANC_MYCTU
[Raw transfer]




0HO_B_9(4DDM)
PANC_MYCTU
[Raw transfer]




ACY_B_10(3AG6)
PANC_STAA8
[Raw transfer]




ACY_A_4(3AG6)
PANC_STAA8
[Raw transfer]




0HN_A_3(4DDK)
PANC_MYCTU
[Raw transfer]




I2E_A_6(4EF6)
PANC_MYCTU
[Raw transfer]




MS0_B_9(4DDH)
PANC_MYCTU
[Raw transfer]




I2E_B_17(4EF6)
PANC_MYCTU
[Raw transfer]




MS0_A_5(4DDH)
PANC_MYCTU
[Raw transfer]




0OC_B_10(4EFK)
PANC_MYCTU
[Raw transfer]




0OC_A_3(4EFK)
PANC_MYCTU
[Raw transfer]




EOH_B_11(1N2H)
PANC_MYCTU
[Raw transfer]




EOH_B_13(1MOP)
PANC_MYCTU
[Raw transfer]




BAL_F_6(1N2O)
PANC_MYCTU
[Raw transfer]




21 PsiBlast_CBE 92.6250%-106 - C4 -2X3F 8.6 PANC_STAAR
110 HHSearch 91.4050% -99 - C4 -3AG6 9.1 PANC_STAA8
3 PsiBlast_PDB 90.6650%-100 - C4 -3AG6 9.1 PANC_STAA8
1 PsiBlast_PDB 90.4050% -99 - C4 -2X3F 7.4 PANC_STAAR
22 PsiBlast_CBE 89.6550% -99 - C4 -3AG6 9.2 PANC_STAA8
113 HHSearch 88.2546%-102 - C4 -3MXT 2.1 PANC_CAMJE
2 PsiBlast_PDB 88.2350%-117 - C4 -3AG5 - PANC_STAA8 -
114 HHSearch 87.1651% -97 - C4 -2EJC - PANC_THEMA -
25 PsiBlast_CBE 86.6345%-109 - C4 -3INN 8.3 PANC_BRUME
4 PsiBlast_PDB 86.4150% -97 - C4 -2EJC - PANC_THEMA -
8 PsiBlast_PDB 86.1045%-108 - C4 -3INN 7.5 PANC_BRUME
111 HHSearch 84.0443%-104 - C4 -3INN 7.5 PANC_BRUME
24 PsiBlast_CBE 83.7145%-117 - C4 -3INN 7.5 PANC_BRUME
5 PsiBlast_PDB 82.7746% -38 - C4 -3MXT 3.4 PANC_CAMJE
6 PsiBlast_PDB 82.3946% -40 - C4 -3UY4 6.6 PANC_CAMJE
117 HHSearch 82.1447% -63 - C4 -1V8F 1.7 PANC_THET8
7 PsiBlast_PDB 80.6745% -76 - C4 -1V8F 1.7 PANC_THET8
11 PsiBlast_PDB 80.3140% -39 - C4 -3Q12 2.8 PANC_YERPE
26 PsiBlast_CBE 80.2040% -53 - C4 -3Q12 2.9 PANC_YERPE
30 PsiBlast_CBE 79.7240% -46 - C4 -3Q10 6.0 PANC_YERPE
28 PsiBlast_CBE 79.6840% -46 - C4 -3Q12 3.0 PANC_YERPE
31 PsiBlast_CBE 79.4240% -41 - C4 -3Q10 6.4 PANC_YERPE
23 PsiBlast_CBE 79.3945% -74 - C4 -1V8F 2.8 PANC_THET8
116 HHSearch 79.2540% -42 - C4 -3Q12 2.8 PANC_YERPE
10 PsiBlast_PDB 79.1240% -39 - C4 -3Q10 6.5 PANC_YERPE
9 PsiBlast_PDB 79.1244% -70 - C4 -1UFV 3.2 PANC_THET8
101 Fugue 78.7841% -40 - C4 -1IHO 2.2 PANC_ECOLI
12 PsiBlast_PDB 78.3640% -40 - C4 -1IHO 2.2 PANC_ECOLI
27 PsiBlast_CBE 78.3140% -39 - C4 -3Q12 2.7 PANC_YERPE
32 PsiBlast_CBE 76.6340% -39 - C4 -1IHO 2.5 PANC_ECOLI
13 PsiBlast_PDB 75.9739% -39 - C4 -3MUE 3.1 PANC_SALTY
112 HHSearch 75.8039% -66 * C4 *3COV 2.5 PANC_MYCTU
115 HHSearch 75.5740% -44 - C4 -3UK2 6.5 PANC_BURTA
14 PsiBlast_PDB 75.2038% -47 - C4 -3UK2 6.5 PANC_BURTA
34 PsiBlast_CBE 75.0839% -39 - C4 -3MUE 3.3 PANC_SALTY
36 PsiBlast_CBE 74.6238% -48 - C4 -3UK2 6.6 PANC_BURTA
92 PsiBlast_CBE 74.4640% -58 - C4 -4DDM 2.8 PANC_MYCTU
98 PsiBlast_CBE 73.9240% -56 - C4 -3IVX 7.3 PANC_MYCTU
88 PsiBlast_CBE 73.8740% -56 - C4 -4FZJ 2.2 PANC_MYCTU
90 PsiBlast_CBE 73.8540% -61 - C4 -4DE5 3.9 PANC_MYCTU
58 PsiBlast_CBE 73.7540% -60 - C4 -4EF6 4.8 PANC_MYCTU
70 PsiBlast_CBE 73.7340% -60 - C4 -1N2J 2.9 PANC_MYCTU
62 PsiBlast_CBE 73.7140% -59 - C4 -3ISJ 4.9 PANC_MYCTU
48 PsiBlast_CBE 73.7040% -53 - C4 -4MUH 6.7 PANC_MYCTO
80 PsiBlast_CBE 73.6940% -63 - C4 -1MOP 2.9 PANC_MYCTU
75 PsiBlast_CBE 73.6140% -62 - C4 -1N2H 9.7 PANC_MYCTU
96 PsiBlast_CBE 73.5940% -58 - C4 -4DDH 4.5 PANC_MYCTU
84 PsiBlast_CBE 73.5140% -58 - C4 -4G5F 3.7 PANC_MYCTU
65 PsiBlast_CBE 73.4440% -60 - C4 -2A86 6.9 PANC_MYCTU
78 PsiBlast_CBE 73.4340% -67 - C4 -1N2E 8.8 PANC_MYCTU
40 PsiBlast_CBE 73.3940% -58 - C4 -4MUL 8.4 PANC_MYCTO
44 PsiBlast_CBE 73.3540% -54 - C4 -4MUJ 8.3 PANC_MYCTO
73 PsiBlast_CBE 73.3240% -61 - C4 -1N2I 9.8 PANC_MYCTU
100 PsiBlast_CBE 73.0640% -60 - C4 -3IVG 2.6 PANC_MYCTU
50 PsiBlast_CBE 72.9940% -56 - C4 -4MUG 6.9 PANC_MYCTO
86 PsiBlast_CBE 72.9740% -56 - C4 -4G5Y 9.1 PANC_MYCTU
77 PsiBlast_CBE 72.9640% -59 - C4 -1N2G 9.5 PANC_MYCTU
38 PsiBlast_CBE 72.9640% -58 - C4 -4MUN 5.0 PANC_MYCTO
74 PsiBlast_CBE 72.9540% -62 - C4 -1N2H 9.5 PANC_MYCTU
46 PsiBlast_CBE 72.9540% -57 - C4 -4MUI 7.6 PANC_MYCTO
72 PsiBlast_CBE 72.9340% -63 - C4 -1N2I 9.8 PANC_MYCTU
76 PsiBlast_CBE 72.9240% -64 - C4 -1N2G 8.6 PANC_MYCTU
79 PsiBlast_CBE 72.8640% -66 - C4 -1N2B 8.8 PANC_MYCTU
94 PsiBlast_CBE 72.8540% -58 - C4 -4DDK 4.2 PANC_MYCTU
19 PsiBlast_PDB 72.4940% -60 - C4 -1N2B 8.2 PANC_MYCTU
71 PsiBlast_CBE 72.4840% -57 - C4 -1N2J 3.0 PANC_MYCTU
82 PsiBlast_CBE 72.3840% -55 - C4 -4MQ6 7.9 PANC_MYCTO
20 PsiBlast_PDB 72.3040% -60 - C4 -1N2E 9.2 PANC_MYCTU
93 PsiBlast_CBE 72.2340% -63 - C4 -4DDK 4.0 PANC_MYCTU
35 PsiBlast_CBE 72.0939% -35 - C4 -3MUE 2.9 PANC_SALTY
56 PsiBlast_CBE 71.6640% -56 - C4 -4EFK 3.2 PANC_MYCTU
18 PsiBlast_PDB 71.6540% -59 - C4 -1MOP 2.9 PANC_MYCTU
41 PsiBlast_CBE 71.3340% -61 - C4 -4MUK 9.0 PANC_MYCTO
87 PsiBlast_CBE 71.3240% -62 - C4 -4FZJ 4.4 PANC_MYCTU
67 PsiBlast_CBE 71.3040% -57 - C4 -2A7X 7.0 PANC_MYCTU
64 PsiBlast_CBE 71.3040% -65 - C4 -2A86 6.9 PANC_MYCTU
47 PsiBlast_CBE 71.0940% -63 - C4 -4MUH 6.1 PANC_MYCTO
52 PsiBlast_CBE 70.9840% -57 - C4 -4MUF 7.9 PANC_MYCTO
59 PsiBlast_CBE 70.8740% -64 - C4 -3LE8 8.2 PANC_MYCTU
54 PsiBlast_CBE 70.6640% -56 - C4 -4MUE 8.1 PANC_MYCTO
69 PsiBlast_CBE 70.6140% -54 - C4 -1N2O 3.3 PANC_MYCTU
57 PsiBlast_CBE 70.5940% -62 - C4 -4EF6 4.3 PANC_MYCTU
49 PsiBlast_CBE 70.4740% -60 - C4 -4MUG 6.3 PANC_MYCTO
43 PsiBlast_CBE 70.4440% -63 - C4 -4MUJ 7.8 PANC_MYCTO
81 PsiBlast_CBE 70.4240% -61 - C4 -4MQ6 7.2 PANC_MYCTO
97 PsiBlast_CBE 70.4140% -59 - C4 -3IVX 7.5 PANC_MYCTU
61 PsiBlast_CBE 70.3440% -65 - C4 -3ISJ 5.0 PANC_MYCTU
55 PsiBlast_CBE 70.3440% -61 - C4 -4EFK 3.7 PANC_MYCTU
68 PsiBlast_CBE 70.2240% -66 - C4 -1N2O 3.8 PANC_MYCTU
83 PsiBlast_CBE 70.2040% -63 - C4 -4G5F 3.7 PANC_MYCTU
91 PsiBlast_CBE 70.1740% -60 - C4 -4DDM 2.9 PANC_MYCTU
39 PsiBlast_CBE 70.1140% -62 - C4 -4MUL 7.6 PANC_MYCTO
66 PsiBlast_CBE 69.8140% -61 - C4 -2A84 9.7 PANC_MYCTU
51 PsiBlast_CBE 69.7940% -68 - C4 -4MUF 7.8 PANC_MYCTO
45 PsiBlast_CBE 69.7440% -62 - C4 -4MUI 6.8 PANC_MYCTO
99 PsiBlast_CBE 69.6840% -62 - C4 -3IVG 7.6 PANC_MYCTU
37 PsiBlast_CBE 69.5840% -62 - C4 -4MUN 7.0 PANC_MYCTO