@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22480: (2016-07-04 )
MKIALIAHDKKKQDMVQFTTAYRDILKNHDLYATGTTGLKIHEATGLQIERFQSGPLGGDQQIGALIAANALDLVIFLRDPLTAQPHEPDVSALIRLCDVYSIPLATNMGTAEILVRTLDEGVFEFRDLLRGEEPNV

Atome Classification :

(41 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGH_I_9(1IK4)
MGSA_ECOLI
[Raw transfer]




PGH_K_11(1IK4)
MGSA_ECOLI
[Raw transfer]




PGH_G_7(1IK4)
MGSA_ECOLI
[Raw transfer]




PGH_H_8(1IK4)
MGSA_ECOLI
[Raw transfer]




PGH_L_12(1IK4)
MGSA_ECOLI
[Raw transfer]




PGH_J_10(1IK4)
MGSA_ECOLI
[Raw transfer]




PGA_I_9(1EGH)
MGSA_ECOLI
[Raw transfer]




PGA_G_7(1EGH)
MGSA_ECOLI
[Raw transfer]




PGA_L_12(1EGH)
MGSA_ECOLI
[Raw transfer]




PGA_K_11(1EGH)
MGSA_ECOLI
[Raw transfer]




PGA_J_10(1S89)
MGSA_ECOLI
[Raw transfer]




PGA_J_10(1EGH)
MGSA_ECOLI
[Raw transfer]




PGA_G_7(1S89)
MGSA_ECOLI
[Raw transfer]




PGA_K_11(1S8A)
MGSA_ECOLI
[Raw transfer]




PGA_H_8(1S8A)
MGSA_ECOLI
[Raw transfer]




PGA_I_9(1S8A)
MGSA_ECOLI
[Raw transfer]




PGA_H_8(1EGH)
MGSA_ECOLI
[Raw transfer]




PGA_K_11(1S89)
MGSA_ECOLI
[Raw transfer]




PGA_J_10(1S8A)
MGSA_ECOLI
[Raw transfer]




PGA_I_9(1S89)
MGSA_ECOLI
[Raw transfer]




PGA_H_8(1S89)
MGSA_ECOLI
[Raw transfer]




PGA_L_12(1S89)
MGSA_ECOLI
[Raw transfer]




PGA_L_12(1S8A)
MGSA_ECOLI
[Raw transfer]




PGA_G_7(1S8A)
MGSA_ECOLI
[Raw transfer]




FMT_K_11(1B93)
MGSA_ECOLI
[Raw transfer]




FMT_M_13(1B93)
MGSA_ECOLI
[Raw transfer]




FMT_I_9(1B93)
MGSA_ECOLI
[Raw transfer]




FMT_J_10(1B93)
MGSA_ECOLI
[Raw transfer]




FMT_N_14(1B93)
MGSA_ECOLI
[Raw transfer]




FMT_J_10(1B93)
MGSA_ECOLI
[Raw transfer]




27 PsiBlast_CBE 88.0956%-173 - C3 -1WO8 - MGSA_THET8 -
3 PsiBlast_PDB 87.8956%-174 - C3 -1WO8 - MGSA_THET8 -
23 PsiBlast_CBE 87.7456%-176 - C3 -1WO8 - MGSA_THET8 -
22 PsiBlast_CBE 87.6959%-160 - C3 -2XW6 - ? -
2 PsiBlast_PDB 87.0459%-149 - C3 -2XW6 - ? -
25 PsiBlast_CBE 86.0756%-169 - C3 -1WO8 - MGSA_THET8 -
24 PsiBlast_CBE 85.6856%-171 - C3 -1WO8 - MGSA_THET8 -
1 PsiBlast_PDB 85.1359%-160 - C3 -2X8W - ? -
21 PsiBlast_CBE 84.8359%-157 - C3 -2XW6 - ? -
26 PsiBlast_CBE 84.5556%-172 - C3 -1WO8 - MGSA_THET8 -
28 PsiBlast_CBE 84.1950%-182 - C3 -1VMD - MGSA_THEMA -
4 PsiBlast_PDB 83.9850%-181 - C3 -1VMD - MGSA_THEMA -
53 HHSearch 83.3957% -49 - C3 -2XW6 - ? -
5 PsiBlast_PDB 83.1550%-190 - C3 -1B93 3.1 MGSA_ECOLI
44 PsiBlast_CBE 83.1349%-187 - C3 -1S89 3.5 MGSA_ECOLI
33 PsiBlast_CBE 82.5350%-192 - C3 -1IK4 4.4 MGSA_ECOLI
8 PsiBlast_PDB 82.0849%-182 - C3 -1S89 3.7 MGSA_ECOLI
7 PsiBlast_PDB 82.0450%-190 - C3 -1IK4 3.6 MGSA_ECOLI
45 PsiBlast_CBE 82.0049%-190 - C3 -1S89 3.7 MGSA_ECOLI
42 PsiBlast_CBE 82.0049%-183 - C3 -1S89 3.7 MGSA_ECOLI
47 PsiBlast_CBE 81.9949%-194 - C3 -1S8A 3.7 MGSA_ECOLI
31 PsiBlast_CBE 81.8950%-190 - C3 -1IK4 3.4 MGSA_ECOLI
35 PsiBlast_CBE 81.8850%-194 - C3 -1EGH 3.7 MGSA_ECOLI
9 PsiBlast_PDB 81.8649%-192 - C3 -1S8A 3.5 MGSA_ECOLI
40 PsiBlast_CBE 81.7150%-193 - C3 -1B93 3.3 MGSA_ECOLI
6 PsiBlast_PDB 81.6950%-194 - C3 -1EGH 3.5 MGSA_ECOLI
50 PsiBlast_CBE 81.5949%-187 - C3 -1S8A 3.8 MGSA_ECOLI
43 PsiBlast_CBE 81.5749%-187 - C3 -1S89 3.5 MGSA_ECOLI
41 PsiBlast_CBE 81.5749%-184 - C3 -1S89 3.6 MGSA_ECOLI
46 PsiBlast_CBE 81.4849%-190 - C3 -1S8A 3.5 MGSA_ECOLI
36 PsiBlast_CBE 81.2950%-195 - C3 -1EGH 3.6 MGSA_ECOLI
48 PsiBlast_CBE 81.2149%-195 - C3 -1S8A 3.2 MGSA_ECOLI
34 PsiBlast_CBE 81.2050%-195 - C3 -1EGH 3.4 MGSA_ECOLI
30 PsiBlast_CBE 81.1450%-193 - C3 -1IK4 3.7 MGSA_ECOLI
39 PsiBlast_CBE 80.9750%-191 - C3 -1B93 3.0 MGSA_ECOLI
38 PsiBlast_CBE 80.3450%-194 - C3 -1EGH 3.8 MGSA_ECOLI
49 PsiBlast_CBE 79.8949%-190 - C3 -1S8A 3.7 MGSA_ECOLI
32 PsiBlast_CBE 79.7650%-189 - C3 -1IK4 3.6 MGSA_ECOLI
29 PsiBlast_CBE 79.2650%-188 - C3 -1IK4 3.4 MGSA_ECOLI
37 PsiBlast_CBE 78.5750%-193 - C3 -1EGH 3.6 MGSA_ECOLI
51 HHSearch 74.3945% -77 - C3 -1B93 3.1 MGSA_ECOLI