@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22550: (2016-07-04 )
MLNKIYDWVDERLDITPMWRDIADHEVPEHVNPAHHFSAFVYCFGGLTFFVTVIQVLSGMFLTMYYVPDIKNAWESVYYLQNEVAFGQIVRGMHHWGASLVIVMMFLHTLRVFFQGAYKKPRELNWIVGVLIFFVMLGLGFTGYLLPWDMKALFATKVGLQIAEATPLIGTQVKTLLAGHPDIVGAQTLTRFFAIHVFFLPAALFGLMAAHFIMIRKQGISGPL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

OPC_B_19(2E74)
CYB6_MASLA
[Raw transfer]




OPC_B_22(4PV1)
CYB6_MASLA
[Raw transfer]




OPC_B_22(4OGQ)
CYB6_NOSS1
[Raw transfer]




OPC_B_22(4OGQ)
CYB6_NOSS1
[Raw transfer]




OPC_B_19(2E76)
CYB6_MASLA
[Raw transfer]




OPC_B_20(2E75)
CYB6_MASLA
[Raw transfer]




HEM_A_12(2E74)
CYB6_MASLA
[Raw transfer]




HEM_B_11(1Q90)
CYB6_CHLRE
[Raw transfer]




HEM_A_11(2ZT9)
CYB6_NOSS1
[Raw transfer]




HEM_B_12(1Q90)
CYB6_CHLRE
[Raw transfer]




8K6_A_15(4OGQ)
CYB6_NOSS1
[Raw transfer]




22 PsiBlast_CBE 89.7143% 0 - C- -1VF5 - CYB6_MASLA -
21 PsiBlast_CBE 89.7143% 0 - C- -2D2C - CYB6_MASLA -
2 PsiBlast_PDB 89.7143% 0 - C- -2D2C - CYB6_MASLA -
1 PsiBlast_PDB 89.7143% 0 - C- -1VF5 - CYB6_MASLA -
6 PsiBlast_PDB 88.3643%-172 - C8 -4H0L - CYB6_MASLA -
11 PsiBlast_PDB 87.4343%-168 - C8 -4H44 - CYB6_NOSS1 -
8 PsiBlast_PDB 86.5943%-170 - C8 -4I7Z - CYB6_MASLA -
3 PsiBlast_PDB 86.5543%-169 - C8 -2E74 7.1 CYB6_MASLA
7 PsiBlast_PDB 86.5143%-165 - C8 -4H13 - CYB6_MASLA -
9 PsiBlast_PDB 86.4343%-174 - C8 -4PV1 Error CYB6_MASLA
99 HHSearch 86.1844%-169 - C8 -4OGQ Error CYB6_NOSS1
13 PsiBlast_PDB 85.7643%-166 - C8 -1Q90 9.9 CYB6_CHLRE
12 PsiBlast_PDB 85.1343%-168 - C8 -4OGQ 3.9 CYB6_NOSS1
10 PsiBlast_PDB 85.0143%-169 - C8 -2ZT9 8.3 CYB6_NOSS1
5 PsiBlast_PDB 83.2443%-171 - C8 -2E76 Error CYB6_MASLA
4 PsiBlast_PDB 81.9143%-167 - C8 -2E75 Error CYB6_MASLA
16 PsiBlast_PDB 78.9933%-184 - C8 -2QJK - CYB_RHOSH -
41 PsiBlast_CBE 78.5432%-173 - C8 -1ZRT - CYB_RHOCA -
18 PsiBlast_PDB 77.3432%-171 - C8 -1ZRT - CYB_RHOCA -
23 PsiBlast_CBE 77.2533%-185 - C8 -2QJY - CYB_RHOSH -