@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22600: (2016-07-05 )
MKRDKVQTLHGEIHIPGDKSISHRSVMFGALAAGTTTVKNFLPGADCLSTIDCFRKMGVHIEQSSSDVVIHGKGIDALKEPESLLDVGNSGTTIRLMLGILAGRPFYSAVAGDESIAKRPMKRVTEPLKKMGAKIDGRAGGEFTPLSVSGASLKGIDYVSPVASAQIKSAVLLAGLQAEGTTTVTEPHKSRDHTERMLSAFGVKLSEDQTSVSIAGGQKLTAADIFVPGDISSAAFFLAAGAMVPNSRIVLKNVGLNPTRTGIIDVLQNMGAKLEIKPSADSGAEPYGDLIIETSSLKAVEIGGDIIPRLIDEIPIIALLATQAEGTTVIKDAAELKVKETNRIDTVVSELRKLGAEIEPTADGMKVYGKQTLKGGAAVSSHGDHRIGMMLGIASCITEEPIEIEHTDAIHVSYPTFFEHLNKLSKKS

Atome Classification :

(28 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GG9_A_2(2PQB)
AROA_AGRSC
[Raw transfer]




GG9_A_2(2PQD)
AROA_AGRSC
[Raw transfer]




RC1_A_2(2PQC)
AROA_AGRSC
[Raw transfer]




RC1_A_2(2PQC)
AROA_AGRSC
[Raw transfer]




S3P_A_2(2GGA)
AROA_AGRSC
[Raw transfer]




S3P_A_4(2GG6)
AROA_AGRSC
[Raw transfer]




S3P_A_2(2GGD)
AROA_AGRSC
[Raw transfer]




S3P_A_2(4ZND)
AROA_COXBU
[Raw transfer]




GPJ_A_3(2GGA)
AROA_AGRSC
[Raw transfer]




GPJ_A_3(2GGD)
AROA_AGRSC
[Raw transfer]




23 PsiBlast_CBE 95.7368%-112 - C7 -3RMT - AROA1_BACHD -
1 PsiBlast_PDB 95.0668%-112 - C7 -3RMT - AROA1_BACHD -
21 PsiBlast_CBE 94.6368%-107 - C7 -3RMT - AROA1_BACHD -
22 PsiBlast_CBE 94.5968%-105 - C7 -3RMT - AROA1_BACHD -
42 HHSearch 93.0967% -93 - C7 -3RMT - AROA1_BACHD -
3 PsiBlast_PDB 83.4052% -38 - C7 -1RF5 - AROA_STRPN -
25 PsiBlast_CBE 81.4752% -32 - C7 -1RF6 - AROA_STRPN -
24 PsiBlast_CBE 81.1152% -29 - C7 -1RF6 - AROA_STRPN -
26 PsiBlast_CBE 80.9252% -31 - C7 -1RF6 - AROA_STRPN -
4 PsiBlast_PDB 80.7852% -32 - C7 -1RF6 - AROA_STRPN -
28 PsiBlast_CBE 80.7652% -31 - C7 -1RF4 - AROA_STRPN -
27 PsiBlast_CBE 80.7252% -30 - C7 -1RF4 - AROA_STRPN -
2 PsiBlast_PDB 80.1452% -29 - C7 -1RF4 - AROA_STRPN -
29 PsiBlast_CBE 80.0252% -30 - C7 -1RF4 - AROA_STRPN -
9 PsiBlast_PDB 78.4448% -40 - C7 -4N3P - ? -
40 HHSearch 74.1553% 19 - C7 -1RF6 - AROA_STRPN -
38 PsiBlast_CBE 73.2546% -3 - C7 -3ROI - AROA_COXBU -
5 PsiBlast_PDB 72.5146% -6 - C7 -3ROI - AROA_COXBU -
11 PsiBlast_PDB 71.5446% 5 - C7 -5BUF - ? -
44 HHSearch 71.4246% 8 - C7 -5BUF - ? -
8 PsiBlast_PDB 71.2046% 1 - C7 -4ZND 4.3 AROA_COXBU
17 PsiBlast_PDB 70.9641% -7 - C7 -2GGA 5.1 AROA_AGRSC
13 PsiBlast_PDB 70.9341% -6 - C7 -2GGD 5.0 AROA_AGRSC
14 PsiBlast_PDB 70.8241% -6 - C7 -2PQD 9.1 AROA_AGRSC
19 PsiBlast_PDB 70.4141% -7 - C7 -2PQC 6.9 AROA_AGRSC
18 PsiBlast_PDB 70.3341% -6 - C7 -2PQB 9.5 AROA_AGRSC
16 PsiBlast_PDB 69.9841% -5 - C7 -2GG6 4.5 AROA_AGRSC
41 HHSearch 69.8042% -4 - C7 -2PQC 6.9 AROA_AGRSC