@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22630: (2016-07-05 )
MFKLDLQPSEKLFIPFITAGDPVPEVSIELAKSLQKAGATALELGVAYSDPLADGPVIQRASKRALDQGMNIVKAIELGGEMKKNGVNIPIILFTYYNPVLQLNKEYFFALLRENHIDGLLVPDLPLEESNSLQEECKSHEVTYISLVAPTSESRLKTIIEQAEGFVYCVSSLGVTGVRNEFNSSVYPFIRTVKNLSTVPVAVGFGISNREQVIKMNEISDGVVVGSALVRKIEELKDRLISAETRNQALQEFEDYAMAFSGLYSLK

Atome Classification :

(67 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HPF_A_4(1TJP)
TRPA_SALTY
[Raw transfer]




IAD_A_4(1K3U)
TRPA_SALTY
[Raw transfer]




IGP_A_3(1QOQ)
TRPA_SALTY
[Raw transfer]




IGP_A_4(2RH9)
TRPA_SALTY
[Raw transfer]




FIP_A_4(1A5S)
TRPA_SALTY
[Raw transfer]




IGP_A_3(1KFB)
TRPA_SALTY
[Raw transfer]




HSP_A_5(1CW2)
TRPA_SALTY
[Raw transfer]




IGP_A_4(2RHG)
TRPA_SALTY
[Raw transfer]




HE1_A_4(1C8V)
TRPA_SALTY
[Raw transfer]




FIP_A_5(1A50)
TRPA_SALTY
[Raw transfer]




F19_A_3(2CLO)
TRPA_SALTY
[Raw transfer]




IPL_A_3(1QOP)
TRPA_SALTY
[Raw transfer]




HE1_A_5(1C29)
TRPA_SALTY
[Raw transfer]




IPL_A_4(2TRS)
TRPA_SALTY
[Raw transfer]




IAG_A_4(1K7E)
TRPA_SALTY
[Raw transfer]




IPL_A_4(1KFC)
TRPA_SALTY
[Raw transfer]




FIP_A_4(1FUY)
TRPA_SALTY
[Raw transfer]




IAG_A_4(1K8Z)
TRPA_SALTY
[Raw transfer]




F19_A_4(2CLH)
TRPA_SALTY
[Raw transfer]




IAV_E_5(1K7F)
TRPA_SALTY
[Raw transfer]




IPL_A_7(1BEU)
TRPA_SALTY
[Raw transfer]




F6F_A_3(2CLM)
TRPA_SALTY
[Raw transfer]




F9F_A_3(3PR2)
TRPA_SALTY
[Raw transfer]




F9F_A_3(4HT3)
TRPA_SALTY
[Raw transfer]




F6F_A_3(5BW6)
?
[Raw transfer]




F9F_A_3(4HN4)
TRPA_SALTY
[Raw transfer]




F6F_A_3(2CLF)
TRPA_SALTY
[Raw transfer]




NHP_A_4(1CX9)
TRPA_SALTY
[Raw transfer]




F9F_A_3(4HPJ)
TRPA_SALTY
[Raw transfer]




F9F_A_3(4XUG)
TRPA_SALTY
[Raw transfer]




F9F_A_3(2CLL)
TRPA_SALTY
[Raw transfer]




G3P_A_3(2J9X)
TRPA_SALTY
[Raw transfer]




F9F_A_4(2CLI)
TRPA_SALTY
[Raw transfer]




IPL_A_6(1WXJ)
TRPA_THET2
[Raw transfer]




F6F_A_4(2CLE)
TRPA_SALTY
[Raw transfer]




F6F_A_3(4KKX)
TRPA_SALTY
[Raw transfer]




G3P_A_4(2TSY)
TRPA_SALTY
[Raw transfer]




F9F_A_3(4HPX)
TRPA_SALTY
[Raw transfer]




HF1_A_5(1C9D)
TRPA_SALTY
[Raw transfer]




G3P_A_3(1WBJ)
TRPA_SALTY
[Raw transfer]




G3H_A_3(2CLK)
TRPA_SALTY
[Raw transfer]




F6F_A_3(4Y6G)
?
[Raw transfer]




13P_A_4(1K8Y)
TRPA_SALTY
[Raw transfer]




GOL_A_23(1WQ5)
TRPA_ECOLI
[Raw transfer]




G3P_A_6(3CEP)
TRPA_SALTY
[Raw transfer]




IGP_A_7(1A5B)
TRPA_SALTY
[Raw transfer]




F6F_A_4(4ZQC)
?
[Raw transfer]




F6F_A_4(4WX2)
TRPA_SALTY
[Raw transfer]




DMS_A_5(4ZQC)
?
[Raw transfer]




89 HHSearch 88.1240% -85 - C3 -1RD5 - TRPA_MAIZE -
4 PsiBlast_PDB 87.6739% -83 - C3 -1TJR - TRPA_MAIZE -
14 PsiBlast_PDB 87.2639%-108 - C3 -2E09 - TRPA_PYRFU -
2 PsiBlast_PDB 86.5239% -84 - C3 -1RD5 - TRPA_MAIZE -
103 Fugue 86.2037% -98 - C3 -1GEQ - TRPA_PYRFU -
82 HHSearch 85.4843%-127 - C3 -1UJP - TRPA_THET2 -
88 HHSearch 85.2837% -95 - C3 -1GEQ - TRPA_PYRFU -
15 PsiBlast_PDB 84.8139%-110 - C3 -2DZT - TRPA_PYRFU -
5 PsiBlast_PDB 84.7239%-106 - C3 -2DZS - TRPA_PYRFU -
8 PsiBlast_PDB 84.6239%-115 - C3 -1GEQ - TRPA_PYRFU -
10 PsiBlast_PDB 84.4439%-113 - C3 -5E0K - TRPA_PYRFU -
7 PsiBlast_PDB 84.0739%-106 - C3 -2DZW - TRPA_PYRFU -
11 PsiBlast_PDB 83.6339%-106 - C3 -2DZP - TRPA_PYRFU -
12 PsiBlast_PDB 83.5839%-106 - C3 -2DZV - TRPA_PYRFU -
13 PsiBlast_PDB 83.4139%-107 - C3 -2DZU - TRPA_PYRFU -
6 PsiBlast_PDB 83.1839%-111 - C3 -2DZX - TRPA_PYRFU -
16 PsiBlast_PDB 82.8733%-164 - C- -3THA - TRPA_CAMJE -
9 PsiBlast_PDB 82.4639%-106 - C3 -1WDW - TRPA_PYRFU -
1 PsiBlast_PDB 81.4040%-112 - C3 -1WXJ 5.5 TRPA_THET2
3 PsiBlast_PDB 81.1939%-112 - C3 -2EKC - TRPA_AQUAE -
27 PsiBlast_CBE 79.0635%-105 - C3 -4KKX 4.1 TRPA_SALTY
61 PsiBlast_CBE 78.9835%-102 - C3 -1WBJ 4.5 TRPA_SALTY
60 PsiBlast_CBE 78.9835%-102 - C3 -2CLK 4.5 TRPA_SALTY
31 PsiBlast_CBE 78.8635%-103 - C3 -4HN4 5.4 TRPA_SALTY
62 PsiBlast_CBE 78.8435%-102 - C3 -1QOP 4.2 TRPA_SALTY
55 PsiBlast_CBE 78.3335%-101 - C3 -1C8V 4.0 TRPA_SALTY
56 PsiBlast_CBE 78.2235%-101 - C3 -1C29 3.1 TRPA_SALTY
30 PsiBlast_CBE 78.1735%-105 - C3 -4HPJ 4.2 TRPA_SALTY
28 PsiBlast_CBE 78.1035%-106 - C3 -4HT3 4.4 TRPA_SALTY
25 PsiBlast_CBE 78.0435%-105 - C3 -4XUG 4.6 TRPA_SALTY
53 PsiBlast_CBE 78.0135%-103 - C3 -1CW2 3.5 TRPA_SALTY
29 PsiBlast_CBE 77.9335%-103 - C3 -4HPX 4.5 TRPA_SALTY
44 PsiBlast_CBE 77.8935%-103 - C3 -1TJP 3.8 TRPA_SALTY
32 PsiBlast_CBE 77.8735%-112 - C3 -2TSY 3.0 TRPA_SALTY
50 PsiBlast_CBE 77.8535%-102 - C3 -1K3U 7.3 TRPA_SALTY
58 PsiBlast_CBE 77.8035%-107 - C3 -1A50 7.7 TRPA_SALTY
59 PsiBlast_CBE 77.7635%-103 - C3 -3CEP 4.8 TRPA_SALTY
57 PsiBlast_CBE 77.7535%-107 - C3 -1A5S 7.4 TRPA_SALTY
49 PsiBlast_CBE 77.7335%-113 - C3 -1K7E 2.4 TRPA_SALTY
36 PsiBlast_CBE 77.6635%-103 - C3 -2J9X 3.8 TRPA_SALTY
51 PsiBlast_CBE 77.6235%-106 - C3 -1FUY 4.2 TRPA_SALTY
54 PsiBlast_CBE 77.4435%-100 - C3 -1C9D 3.2 TRPA_SALTY
40 PsiBlast_CBE 77.4435%-108 - C3 -2CLI 4.1 TRPA_SALTY
23 PsiBlast_CBE 77.0335%-106 - C3 -4ZQC 4.3 ?
17 PsiBlast_PDB 76.8535%-102 - C3 -3PR2 5.7 TRPA_SALTY
73 PsiBlast_CBE 76.2435%-113 * C3 *1KFB 3.6 TRPA_SALTY
52 PsiBlast_CBE 76.0635%-100 - C3 -1CX9 2.4 TRPA_SALTY
45 PsiBlast_CBE 76.0535%-119 - C3 -1QOQ 6.4 TRPA_SALTY
42 PsiBlast_CBE 75.9935%-120 - C3 -2CLF 3.8 TRPA_SALTY
46 PsiBlast_CBE 75.8435%-116 - C3 -1K8Z 3.7 TRPA_SALTY
39 PsiBlast_CBE 75.7735%-111 - C3 -2CLL 4.6 TRPA_SALTY
34 PsiBlast_CBE 75.5735%-120 - C3 -2RHG 2.7 TRPA_SALTY
41 PsiBlast_CBE 75.5635%-111 - C3 -2CLH 3.8 TRPA_SALTY
35 PsiBlast_CBE 75.4535%-120 - C3 -2RH9 3.7 TRPA_SALTY
37 PsiBlast_CBE 75.4435%-109 - C3 -2CLO 5.5 TRPA_SALTY
26 PsiBlast_CBE 75.3435%-120 - C3 -4WX2 4.2 TRPA_SALTY
38 PsiBlast_CBE 75.3235%-118 - C3 -2CLM 3.8 TRPA_SALTY
47 PsiBlast_CBE 75.1835%-118 - C3 -1K8Y 3.0 TRPA_SALTY
33 PsiBlast_CBE 75.1835%-106 - C3 -2TRS 3.7 TRPA_SALTY
43 PsiBlast_CBE 75.0935%-116 - C3 -2CLE 3.5 TRPA_SALTY
74 PsiBlast_CBE 75.0635%-116 - C3 -1KFC 3.5 TRPA_SALTY
71 PsiBlast_CBE 75.0035%-112 - C3 -1BEU 4.9 TRPA_SALTY
24 PsiBlast_CBE 75.0035%-117 - C3 -4Y6G 4.4 ?
48 PsiBlast_CBE 74.8235%-117 - C3 -1K7F 4.5 TRPA_SALTY
75 PsiBlast_CBE 74.3835%-119 - C3 -1WQ5 2.9 TRPA_ECOLI
22 PsiBlast_CBE 74.3235%-115 - C3 -5BW6 3.9 ?
72 PsiBlast_CBE 73.4435%-124 - C3 -1A5B 3.8 TRPA_SALTY