@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22670: (2016-07-05 )
MNRFLQLCVDGKTLTAGEAETLMNMMMAAEMTPSEMGGILSILAHRGETPEELAGFVKAMRAHALTVDGLPDIVDTCGTGGDGISTFNISTASAIVASAAGAKIAKHGNRSVSSKSGSADVLEELEVSIQTTPEKVKSSIETNNMGFLFAPLYHSSMKHVAGTRKELGFRTVFNLLGPLSNPLQAKRQVIGVYSVEKAGLMASALETFQPKHVMFVSSRDGLDELSITAPTDVIELKDGERREYTVSPEDFGFTNGRLEDLQVQSPKESAYLIQNIFENKSSSSALSITAFNAGAAIYTAGITASLKEGTELALETITSGGAAAQLERLKQKEEEIYA

Atome Classification :

(66 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PRP_B_12(4GIU)
TRPD_MYCTU
[Raw transfer]




6M1_A_5(4N93)
TRPD_MYCTU
[Raw transfer]




6M1_B_13(4N93)
TRPD_MYCTU
[Raw transfer]




644_A_3(4M0R)
TRPD_MYCTO
[Raw transfer]




PRP_A_3(3R6C)
TRPD_MYCTU
[Raw transfer]




6F0_A_7(4OWO)
TRPD_MYCTU
[Raw transfer]




PRP_A_3(3R88)
TRPD_MYCTU
[Raw transfer]




6F0_B_14(4OWO)
TRPD_MYCTU
[Raw transfer]




PRP_B_8(3R6C)
TRPD_MYCTU
[Raw transfer]




PRP_B_9(3QQS)
TRPD_MYCTU
[Raw transfer]




PRP_A_3(3QSA)
TRPD_MYCTU
[Raw transfer]




FA0_A_6(4N5V)
TRPD_MYCTU
[Raw transfer]




PRP_B_12(4OWO)
TRPD_MYCTU
[Raw transfer]




PRP_A_5(4OWM)
TRPD_MYCTU
[Raw transfer]




GOL_C_12(2ELC)
TRPD_THET8
[Raw transfer]




PRP_B_7(3QSA)
TRPD_MYCTU
[Raw transfer]




PRP_A_3(4N5V)
TRPD_MYCTU
[Raw transfer]




GOL_D_13(2ELC)
TRPD_THET8
[Raw transfer]




PRP_A_5(4OWU)
TRPD_MYCTU
[Raw transfer]




PRP_A_7(4N93)
TRPD_MYCTU
[Raw transfer]




FA0_B_14(4N5V)
TRPD_MYCTU
[Raw transfer]




PRP_C_14(3UU1)
TRPD_MYCTU
[Raw transfer]




GOL_C_11(2ELC)
TRPD_THET8
[Raw transfer]




GOL_A_9(2ELC)
TRPD_THET8
[Raw transfer]




GOL_A_9(2ELC)
TRPD_THET8
[Raw transfer]




PRP_A_5(3QQS)
TRPD_MYCTU
[Raw transfer]




5RG_B_14(4OWN)
TRPD_MYCTU
[Raw transfer]




PRP_B_4(4X5B)
TRPD_MYCTU
[Raw transfer]




636_A_6(4GIU)
TRPD_MYCTU
[Raw transfer]




PRP_B_7(3R88)
TRPD_MYCTU
[Raw transfer]




PRP_B_9(4N93)
TRPD_MYCTU
[Raw transfer]




PRP_B_12(4OWU)
TRPD_MYCTU
[Raw transfer]




PRP_A_3(4GIU)
TRPD_MYCTU
[Raw transfer]




PRP_A_3(4GIU)
TRPD_MYCTU
[Raw transfer]




PRP_B_11(4GKM)
TRPD_MYCTU
[Raw transfer]




PRP_C_13(3QQS)
TRPD_MYCTU
[Raw transfer]




PRP_B_10(4OWM)
TRPD_MYCTU
[Raw transfer]




PRP_B_10(4N5V)
TRPD_MYCTU
[Raw transfer]




PRP_A_5(4OWO)
TRPD_MYCTU
[Raw transfer]




PRP_A_7(4X58)
TRPD_MYCTU
[Raw transfer]




PRP_A_5(4OWQ)
TRPD_MYCTU
[Raw transfer]




PRP_A_3(4GKM)
TRPD_MYCTU
[Raw transfer]




17C_A_8(3QQS)
TRPD_MYCTU
[Raw transfer]




BE2_A_2(4YI7)
TRPD_ACIAD
[Raw transfer]




PRP_A_3(4X5C)
TRPD_MYCTU
[Raw transfer]




PRP_A_3(4X5B)
TRPD_MYCTU
[Raw transfer]




14B_C_18(3UU1)
TRPD_MYCTU
[Raw transfer]




PRP_B_6(4X59)
TRPD_MYCTU
[Raw transfer]




PRP_B_12(4OWN)
TRPD_MYCTU
[Raw transfer]




17C_B_12(3QQS)
TRPD_MYCTU
[Raw transfer]




17N_A_6(3R6C)
TRPD_MYCTU
[Raw transfer]




PRP_A_3(4X59)
TRPD_MYCTU
[Raw transfer]




PRP_B_6(3GBR)
TRPD_SULSO
[Raw transfer]




POP_A_3(4OWS)
TRPD_MYCTU
[Raw transfer]




POP_B_6(4X5C)
TRPD_MYCTU
[Raw transfer]




BE2_B_6(4X5D)
TRPD_MYCTU
[Raw transfer]




BE2_A_3(4X5D)
TRPD_MYCTU
[Raw transfer]




BE2_B_4(4OWV)
TRPD_MYCTU
[Raw transfer]




4M0_A_4(4OWS)
TRPD_MYCTU
[Raw transfer]




FA0_B_4(4N8Q)
TRPD_MYCTU
[Raw transfer]




FA0_A_3(4N8Q)
TRPD_MYCTU
[Raw transfer]




90 HHSearch 93.1436%-104 - C7 -1O17 - TRPD_SULSO -
30 PsiBlast_CBE 89.4838% -98 - C7 -1ZXY - TRPD_SULSO -
6 PsiBlast_PDB 89.2838%-110 - C7 -1O17 - TRPD_SULSO -
22 PsiBlast_CBE 89.2738%-103 - C7 -2GVQ - TRPD_SULSO -
27 PsiBlast_CBE 89.1738% -98 - C7 -1ZYK - TRPD_SULSO -
37 PsiBlast_CBE 89.1437%-103 - C7 -3GBR 3.4 TRPD_SULSO
26 PsiBlast_CBE 89.1238% -98 - C7 -1ZYK - TRPD_SULSO -
23 PsiBlast_CBE 89.0938%-107 - C7 -2GVQ - TRPD_SULSO -
8 PsiBlast_PDB 88.9638% -97 - C7 -1ZXY - TRPD_SULSO -
10 PsiBlast_PDB 88.6038%-104 - C7 -2GVQ - TRPD_SULSO -
25 PsiBlast_CBE 88.4338% -95 - C7 -1ZYK - TRPD_SULSO -
29 PsiBlast_CBE 88.4238% -97 - C7 -1ZXY - TRPD_SULSO -
28 PsiBlast_CBE 88.2038% -98 - C7 -1ZXY - TRPD_SULSO -
33 PsiBlast_CBE 88.1638%-104 - C7 -1GXB - TRPD_SULSO -
24 PsiBlast_CBE 87.7038%-106 - C7 -2GVQ - TRPD_SULSO -
7 PsiBlast_PDB 87.5238%-106 - C7 -1GXB - TRPD_SULSO -
9 PsiBlast_PDB 87.3438%-100 - C7 -1ZYK - TRPD_SULSO -
31 PsiBlast_CBE 86.8338% -98 - C7 -1GXB - TRPD_SULSO -
32 PsiBlast_CBE 86.5938%-105 - C7 -1GXB - TRPD_SULSO -
85 HHSearch 84.4240% -19 - C7 -4HKM - TRPD_XANCP -
89 HHSearch 83.8442% -24 - C7 -2ELC 3.5 TRPD_THET8
84 HHSearch 81.4939% -1 - C7 -4YI7 3.9 TRPD_ACIAD
39 PsiBlast_CBE 81.3633% -30 - C7 -4N93 6.7 TRPD_MYCTU
42 PsiBlast_CBE 80.9333% -30 - C7 -3UU1 4.9 TRPD_MYCTU
14 PsiBlast_PDB 80.7333% -29 - C7 -4N5V 6.9 TRPD_MYCTU
66 PsiBlast_CBE 80.7133% -27 - C7 -4OWM 4.4 TRPD_MYCTU
58 PsiBlast_CBE 80.5933% -29 - C7 -4OWV 2.6 TRPD_MYCTU
41 PsiBlast_CBE 80.5133% -33 - C7 -4N5V 6.5 TRPD_MYCTU
51 PsiBlast_CBE 80.1633% -24 - C7 -3QSA 6.4 TRPD_MYCTU
61 PsiBlast_CBE 80.0533% -32 - C7 -4OWS 4.2 TRPD_MYCTU
63 PsiBlast_CBE 80.0233% -25 - C7 -4OWO 6.6 TRPD_MYCTU
16 PsiBlast_PDB 80.0233% -29 - C7 -4N93 6.3 TRPD_MYCTU
73 PsiBlast_CBE 80.0032% -29 - C7 -4X5D 3.1 TRPD_MYCTU
65 PsiBlast_CBE 79.9033% -26 - C7 -4OWN 5.3 TRPD_MYCTU
60 PsiBlast_CBE 79.9033% -24 - C7 -4OWU 6.5 TRPD_MYCTU
18 PsiBlast_PDB 79.8633% -24 - C7 -3QQS 5.7 TRPD_MYCTU
67 PsiBlast_CBE 79.8233% -24 - C7 -4OWM 6.1 TRPD_MYCTU
40 PsiBlast_CBE 79.7733% -33 - C7 -4N8Q 3.2 TRPD_MYCTU
62 PsiBlast_CBE 79.6833% -26 - C7 -4OWQ 6.1 TRPD_MYCTU
59 PsiBlast_CBE 79.5033% -25 - C7 -4OWU 6.0 TRPD_MYCTU
48 PsiBlast_CBE 79.3433% -30 - C7 -3R88 6.4 TRPD_MYCTU
82 PsiBlast_CBE 79.2932% -29 - C7 -4X59 4.1 TRPD_MYCTU
68 PsiBlast_CBE 79.2533% -28 - C7 -4M0R 7.1 TRPD_MYCTO
87 HHSearch 79.2233% -27 - C7 -4GIU 6.1 TRPD_MYCTU
47 PsiBlast_CBE 79.1533% -31 - C7 -3R88 6.9 TRPD_MYCTU
74 PsiBlast_CBE 79.1132% -27 - C7 -4X5D 3.2 TRPD_MYCTU
57 PsiBlast_CBE 79.1133% -22 - C7 -3QQS 6.1 TRPD_MYCTU
83 PsiBlast_CBE 79.1032% -28 - C7 -4X59 4.0 TRPD_MYCTU
49 PsiBlast_CBE 79.0633% -25 - C7 -3R6C 6.4 TRPD_MYCTU
50 PsiBlast_CBE 78.9233% -23 - C7 -3R6C 5.6 TRPD_MYCTU
64 PsiBlast_CBE 78.6133% -24 - C7 -4OWO 6.5 TRPD_MYCTU
70 PsiBlast_CBE 78.5733% -24 - C7 -4GKM 6.4 TRPD_MYCTU
80 PsiBlast_CBE 78.4632% -23 - C7 -4X5B 4.5 TRPD_MYCTU
72 PsiBlast_CBE 78.4633% -23 - C7 -4GIU 6.0 TRPD_MYCTU
56 PsiBlast_CBE 78.4433% -27 - C7 -3QQS 4.0 TRPD_MYCTU
15 PsiBlast_PDB 78.4433% -24 - C7 -4N8Q 2.8 TRPD_MYCTU
20 PsiBlast_PDB 78.4333% -26 - C7 -3QSA 6.1 TRPD_MYCTU
77 PsiBlast_CBE 78.3532% -27 - C7 -4X58 5.8 TRPD_MYCTU
69 PsiBlast_CBE 78.3033% -24 - C7 -4GKM 5.8 TRPD_MYCTU
79 PsiBlast_CBE 77.6832% -24 - C7 -4X5C 6.5 TRPD_MYCTU
78 PsiBlast_CBE 77.6532% -27 - C7 -4X5C 3.9 TRPD_MYCTU
34 PsiBlast_CBE 77.6443% 6 - C7 -2ELC 3.3 TRPD_THET8
81 PsiBlast_CBE 77.2032% -21 - C7 -4X5B 1.3 TRPD_MYCTU
12 PsiBlast_PDB 75.8743% 9 - C7 -2ELC 3.5 TRPD_THET8
35 PsiBlast_CBE 74.9443% 5 - C7 -2ELC 3.2 TRPD_THET8
71 PsiBlast_CBE 69.1233% -23 - C7 -4GIU 7.6 TRPD_MYCTU