@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22700: (2016-07-05 )
MKTLHVQTASSSYPVFIGQGIRKKACELLTSLNRPLTRIMFVTDEEVDRLYGDEMLHLLQEKWPVKKVTVPSGEQAKSMDMYTKLQSEAIRFHMDRSSCIIAFGGGVVGDLAGFVAATFMRGIDFIQMPTTLLAHDSAVGGKVAVNHPLGKNLIGAFYQPKAVLYDTDFLRSLPEKELRSGMAEVIKHAFIYDRAFLEELLNIHSLRDITNDQLNDMIFKGISIKASVVQQDEKEEGIRAYLNFGHTLGHAVEAEYGYGQITHGDAVALGMQFALYISEKTVGCEMDRKRLVSWLKSLGYPSQIRKETETSVLLNRMMNDKKTRGGKIQFIVLNELGKVADHTFSRNELESWLNKWRLEETS

Atome Classification :

(39 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_A_6(1DQS)
ARO1_EMENI
[Raw transfer]




NAD_A_3(3OKF)
AROB_VIBCH
[Raw transfer]




NAD_A_8(1XAG)
AROB_STAAR
[Raw transfer]




NAD_A_3(3OKF)
AROB_VIBCH
[Raw transfer]




NAD_A_6(1DQS)
ARO1_EMENI
[Raw transfer]




NAD_B_8(1DQS)
ARO1_EMENI
[Raw transfer]




NAD_B_6(1XAH)
AROB_STAAR
[Raw transfer]




NAD_A_2(5HVN)
?
[Raw transfer]




NAD_B_5(5EKS)
?
[Raw transfer]




NAD_B_9(1NR5)
ARO1_EMENI
[Raw transfer]




NAD_A_3(5EKS)
?
[Raw transfer]




NAD_A_8(1NR5)
ARO1_EMENI
[Raw transfer]




NAD_A_5(1XAH)
AROB_STAAR
[Raw transfer]




NAD_A_3(5EKS)
?
[Raw transfer]




NAD_A_2(5HVN)
?
[Raw transfer]




NAD_A_7(1NVB)
ARO1_EMENI
[Raw transfer]




NAD_A_19(1NRX)
ARO1_EMENI
[Raw transfer]




NAD_B_6(1SG6)
ARO1_EMENI
[Raw transfer]




NAD_A_5(1SG6)
ARO1_EMENI
[Raw transfer]




NAD_B_20(1NRX)
ARO1_EMENI
[Raw transfer]




NAD_A_5(1SG6)
ARO1_EMENI
[Raw transfer]




ADP_C_13(1NVF)
ARO1_EMENI
[Raw transfer]




ADP_B_12(1NVF)
ARO1_EMENI
[Raw transfer]




ADP_B_7(1NVA)
ARO1_EMENI
[Raw transfer]




ADP_A_6(1NVA)
ARO1_EMENI
[Raw transfer]




ADP_A_11(1NVF)
ARO1_EMENI
[Raw transfer]




CRB_A_5(1XAI)
AROB_STAAR
[Raw transfer]




CRB_B_6(1XAI)
AROB_STAAR
[Raw transfer]




CRB_A_6(1NVD)
ARO1_EMENI
[Raw transfer]




CRB_B_7(1NVD)
ARO1_EMENI
[Raw transfer]




CRB_B_9(1NVB)
ARO1_EMENI
[Raw transfer]




1 PsiBlast_PDB 87.2940% -68 - C3 -3OKF 9.3 AROB_VIBCH
41 HHSearch 86.3740% -44 - C3 -3OKF 9.3 AROB_VIBCH
22 PsiBlast_CBE 85.9938%-101 - C3 -1XAH 8.5 AROB_STAAR
21 PsiBlast_CBE 85.6038% -87 - C3 -1XAI 4.4 AROB_STAAR
3 PsiBlast_PDB 85.4238% -87 - C3 -1XAI 4.6 AROB_STAAR
2 PsiBlast_PDB 85.2838% -85 - C3 -1XAG 7.6 AROB_STAAR
45 HHSearch 81.3339% -28 * C3 *3ZOK - DHQS_ACTCH -
25 PsiBlast_CBE 81.1539% -44 - C3 -3ZOK - DHQS_ACTCH -
4 PsiBlast_PDB 81.0639% -43 - C3 -3ZOK - DHQS_ACTCH -
44 HHSearch 80.8336% -39 - C3 -5EKS 9.0 ?
23 PsiBlast_CBE 80.6939% -42 - C3 -3ZOK - DHQS_ACTCH -
50 HHSearch 80.6339% -28 - C3 -5HVN 8.6 ?
24 PsiBlast_CBE 80.0439% -41 - C3 -3ZOK - DHQS_ACTCH -
5 PsiBlast_PDB 79.4140% -49 - C3 -5HVN 8.6 ?
64 Fugue 77.0530% -68 - C3 -1UJN - ? -
26 PsiBlast_CBE 76.8738% -28 - C3 -5EKS 8.4 ?
48 HHSearch 76.6435% -18 - C3 -3QBE - AROB_MYCTU -
40 HHSearch 76.1636% -35 - C3 -1XAH 7.8 AROB_STAAR
42 HHSearch 74.9628% -38 - C3 -2GRU - DOIS_BACCI -
6 PsiBlast_PDB 74.4738% -24 - C3 -5EKS 9.0 ?
47 HHSearch 69.0633% -11 - C3 -1SG6 8.1 ARO1_EMENI
63 Fugue 68.2032% -7 - C3 -1DQS 9.0 ARO1_EMENI
15 PsiBlast_PDB 63.5334% -8 - C3 -1NVD 5.4 ARO1_EMENI
30 PsiBlast_CBE 63.3834% -8 - C3 -1NVF 5.9 ARO1_EMENI
37 PsiBlast_CBE 62.9534% -8 - C3 -1NR5 8.5 ARO1_EMENI
33 PsiBlast_CBE 62.6634% -11 - C3 -1NVB 4.7 ARO1_EMENI
32 PsiBlast_CBE 62.6434% -8 - C3 -1NVD 5.2 ARO1_EMENI
10 PsiBlast_PDB 62.6034% -9 - C3 -1NR5 9.5 ARO1_EMENI
14 PsiBlast_PDB 62.4534% -10 - C3 -1NVB 7.4 ARO1_EMENI
17 PsiBlast_PDB 62.4234% -14 - C3 -1SG6 8.7 ARO1_EMENI
9 PsiBlast_PDB 62.3034% -8 - C3 -1DQS 9.2 ARO1_EMENI
29 PsiBlast_CBE 62.0434% -7 - C3 -1NVF 4.6 ARO1_EMENI
34 PsiBlast_CBE 61.3934% -8 - C3 -1NVA 4.2 ARO1_EMENI
28 PsiBlast_CBE 61.1434% -18 - C3 -1SG6 8.8 ARO1_EMENI
38 PsiBlast_CBE 61.0534% -8 - C3 -1DQS 8.9 ARO1_EMENI
16 PsiBlast_PDB 60.7234% -5 - C3 -1NVF 5.4 ARO1_EMENI
36 PsiBlast_CBE 60.4734% -9 - C3 -1NRX 6.2 ARO1_EMENI
13 PsiBlast_PDB 59.7234% -11 - C3 -1NVA 5.5 ARO1_EMENI
11 PsiBlast_PDB 59.1234% -11 - C3 -1NRX 6.7 ARO1_EMENI