@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22730: (2016-07-05 )
MMEKTFIMVKPDGVQRQLIGDILSRFERKGLQLAGAKLMRVTEQMAEKHYAEHQGKPFFGELVEFITSGPVFAMVWEGENVIEVTRQLIGKTNPKEALPGTIRGDYGMFVGKNIIHGSDSLESAEREINIFFKNEELVSYQQLMAGWIY

Atome Classification :

(81 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ADP_A_5(1WKL)
NDK_THET8
[Raw transfer]




ADP_A_12(1UCN)
NDKA_HUMAN
[Raw transfer]




ADP_B_13(1UCN)
NDKA_HUMAN
[Raw transfer]




GDP_C_12(3BBF)
NDKB_HUMAN
[Raw transfer]




GTP_B_5(3Q86)
NDK_STAAC
[Raw transfer]




ADP_G_7(1ZS6)
NDK3_HUMAN
[Raw transfer]




ADP_G_7(1ZS6)
NDK3_HUMAN
[Raw transfer]




ATP_B_6(1WKL)
NDK_THET8
[Raw transfer]




GDP_E_16(3BBF)
NDKB_HUMAN
[Raw transfer]




ADP_K_11(1ZS6)
NDK3_HUMAN
[Raw transfer]




ADP_C_6(4UOH)
?
[Raw transfer]




ADP_A_7(2HVD)
NDKA_HUMAN
[Raw transfer]




ADP_A_7(2HVE)
NDKA_HUMAN
[Raw transfer]




UDP_D_13(3Q8V)
NDK_STAAC
[Raw transfer]




GTP_A_3(3Q86)
NDK_STAAC
[Raw transfer]




YYY_A_4(4UOG)
?
[Raw transfer]




ADP_D_12(3Q8U)
NDK_STAAC
[Raw transfer]




GDP_D_12(1NUE)
NDKB_HUMAN
[Raw transfer]




GDP_D_14(3BBF)
NDKB_HUMAN
[Raw transfer]




ADP_A_8(2BEF)
NDKC_DICDI
[Raw transfer]




ADP_E_14(3Q8U)
NDK_STAAC
[Raw transfer]




ADP_C_14(1UCN)
NDKA_HUMAN
[Raw transfer]




ADP_C_12(2BEF)
NDKC_DICDI
[Raw transfer]




GDP_E_13(1NUE)
NDKB_HUMAN
[Raw transfer]




ADP_C_11(2HVD)
NDKA_HUMAN
[Raw transfer]




GDP_F_18(3BBF)
NDKB_HUMAN
[Raw transfer]




GDP_B_9(3BBF)
NDKB_HUMAN
[Raw transfer]




ADP_C_11(2HVE)
NDKA_HUMAN
[Raw transfer]




GDP_A_9(1NUE)
NDKB_HUMAN
[Raw transfer]




ADP_B_9(3Q8U)
NDK_STAAC
[Raw transfer]




ADP_A_7(3Q8U)
NDK_STAAC
[Raw transfer]




ADP_B_9(2HVD)
NDKA_HUMAN
[Raw transfer]




CDP_A_4(4FKX)
?
[Raw transfer]




DAT_C_8(4UOF)
?
[Raw transfer]




GDP_G_7(1WKK)
NDK_THET8
[Raw transfer]




GDP_B_10(1NUE)
NDKB_HUMAN
[Raw transfer]




ADP_A_7(3Q8U)
NDK_STAAC
[Raw transfer]




ADP_B_9(2HVE)
NDKA_HUMAN
[Raw transfer]




GDP_C_11(1NUE)
NDKB_HUMAN
[Raw transfer]




ADP_B_10(2BEF)
NDKC_DICDI
[Raw transfer]




YYY_C_8(4UOG)
?
[Raw transfer]




ADP_I_9(1ZS6)
NDK3_HUMAN
[Raw transfer]




35G_B_8(1BHN)
NDKA1_BOVIN
[Raw transfer]




ADP_D_15(3Q8Y)
NDK_STAAC
[Raw transfer]




DAT_A_4(4UOF)
?
[Raw transfer]




DAT_B_6(4UOF)
?
[Raw transfer]




CDP_E_12(3Q89)
NDK_STAAC
[Raw transfer]




ADP_E_18(3Q8Y)
NDK_STAAC
[Raw transfer]




UDP_B_11(3Q8V)
NDK_STAAC
[Raw transfer]




ADP_B_4(4UOH)
?
[Raw transfer]




ADP_C_11(3Q8U)
NDK_STAAC
[Raw transfer]




35G_E_11(1BHN)
NDKA1_BOVIN
[Raw transfer]




GDP_F_14(1NUE)
NDKB_HUMAN
[Raw transfer]




CDP_B_10(3Q89)
NDK_STAAC
[Raw transfer]




GDP_A_7(3BBF)
NDKB_HUMAN
[Raw transfer]




UDP_A_9(3Q8V)
NDK_STAAC
[Raw transfer]




35G_F_12(1BHN)
NDKA1_BOVIN
[Raw transfer]




ADP_F_16(3Q8U)
NDK_STAAC
[Raw transfer]




35G_C_9(1BHN)
NDKA1_BOVIN
[Raw transfer]




ADP_H_24(3Q8Y)
NDK_STAAC
[Raw transfer]




YYY_B_6(4UOG)
?
[Raw transfer]




PCG_C_11(1BE4)
NDKA2_BOVIN
[Raw transfer]




PCG_A_7(1BE4)
NDKA2_BOVIN
[Raw transfer]




35G_D_10(1BHN)
NDKA1_BOVIN
[Raw transfer]




ADP_A_9(3Q8Y)
NDK_STAAC
[Raw transfer]




35G_A_7(1BHN)
NDKA1_BOVIN
[Raw transfer]




ADP_G_22(3Q8Y)
NDK_STAAC
[Raw transfer]




CMP_R_3(1NHK)
NDK_MYXXA
[Raw transfer]




PCG_B_9(1BE4)
NDKA2_BOVIN
[Raw transfer]




DG_F_12(3BBB)
NDKB_HUMAN
[Raw transfer]




ADP_B_11(3Q8Y)
NDK_STAAC
[Raw transfer]




DG_C_9(3BBB)
NDKB_HUMAN
[Raw transfer]




DG_E_11(3BBB)
NDKB_HUMAN
[Raw transfer]




DA_C_8(3BBB)
NDKB_HUMAN
[Raw transfer]




DA_E_10(3BBB)
NDKB_HUMAN
[Raw transfer]




DG_B_7(3BBB)
NDKB_HUMAN
[Raw transfer]




2 PsiBlast_PDB 93.7471%-125 - C7 -3VVU - ? -
3 PsiBlast_PDB 92.3868%-120 - C7 -3VVT - ? -
32 PsiBlast_CBE 91.3262%-113 - C7 -3Q8U 6.6 NDK_STAAC
22 PsiBlast_CBE 90.9262%-110 - C7 -3Q8Y 5.3 NDK_STAAC
102 HHSearch 90.4672%-106 - C7 -2VU5 - NDK_BACAN -
1 PsiBlast_PDB 90.4672%-106 - C7 -2VU5 - NDK_BACAN -
28 PsiBlast_CBE 90.0262%-110 - C7 -3Q8V 5.1 NDK_STAAC
23 PsiBlast_CBE 89.8162%-111 - C7 -3Q8Y - NDK_STAAC -
6 PsiBlast_PDB 89.3362%-107 - C7 -3Q89 - NDK_STAAC -
36 PsiBlast_CBE 89.2062%-109 - C7 -3Q89 5.2 NDK_STAAC
33 PsiBlast_CBE 89.1862%-104 - C7 -3Q8U 6.3 NDK_STAAC
113 HHSearch 89.1563%-103 - C7 -3Q8U 6.9 NDK_STAAC
7 PsiBlast_PDB 88.8462%-103 - C7 -3Q8U 6.9 NDK_STAAC
8 PsiBlast_PDB 88.7662%-107 - C7 -3Q8V 5.2 NDK_STAAC
30 PsiBlast_CBE 88.6762%-107 - C7 -3Q8U 6.2 NDK_STAAC
4 PsiBlast_PDB 88.6762%-106 - C7 -3Q83 - NDK_STAAC -
27 PsiBlast_CBE 88.6462%-109 - C7 -3Q8Y 3.6 NDK_STAAC
29 PsiBlast_CBE 88.4862%-107 - C7 -3Q8V 4.6 NDK_STAAC
31 PsiBlast_CBE 88.4462%-107 - C7 -3Q8U 6.1 NDK_STAAC
25 PsiBlast_CBE 88.4362%-104 - C7 -3Q8Y 4.9 NDK_STAAC
9 PsiBlast_PDB 88.3562%-109 - C7 -3Q8Y 5.6 NDK_STAAC
21 PsiBlast_CBE 88.3162%-107 - C7 -3Q8Y 4.6 NDK_STAAC
35 PsiBlast_CBE 88.1562%-106 - C7 -3Q89 4.4 NDK_STAAC
34 PsiBlast_CBE 87.9562% -97 - C7 -3Q8U 6.5 NDK_STAAC
37 PsiBlast_CBE 87.8362%-109 - C7 -3Q86 6.9 NDK_STAAC
24 PsiBlast_CBE 87.7662%-109 - C7 -3Q8Y 5.8 NDK_STAAC
84 PsiBlast_CBE 87.2153%-108 - C7 -2HVE 6.1 NDKA_HUMAN
79 PsiBlast_CBE 87.1052%-108 - C7 -1NUE 5.8 NDKB_HUMAN
17 PsiBlast_PDB 87.0559%-130 - C7 -1WKL 5.6 NDK_THET8
51 PsiBlast_CBE 86.6759%-134 - C7 -1WKL 5.9 NDK_THET8
77 PsiBlast_CBE 86.6152%-109 - C7 -1NUE 6.9 NDKB_HUMAN
76 PsiBlast_CBE 86.2052%-109 - C7 -1NUE 6.6 NDKB_HUMAN
52 PsiBlast_CBE 86.2055%-116 - C7 -1BHN 6.9 NDKA1_BOVIN
78 PsiBlast_CBE 86.1452%-109 - C7 -1NUE 6.4 NDKB_HUMAN
61 PsiBlast_CBE 86.1254%-104 - C7 -2HVD 6.9 NDKA_HUMAN
80 PsiBlast_CBE 85.8352%-111 - C7 -1NUE 6.8 NDKB_HUMAN
81 PsiBlast_CBE 85.7852%-112 - C7 -1NUE 6.8 NDKB_HUMAN
19 PsiBlast_PDB 85.7254%-105 - C7 -1BE4 5.9 NDKA2_BOVIN
82 PsiBlast_CBE 85.7153%-112 - C7 -2HVE 5.9 NDKA_HUMAN
56 PsiBlast_CBE 85.7155%-101 - C7 -1BHN 7.2 NDKA1_BOVIN
18 PsiBlast_PDB 85.4855%-110 - C7 -1BHN 7.3 NDKA1_BOVIN
89 PsiBlast_CBE 85.4453%-108 - C7 -4UOG 5.8 ?
96 PsiBlast_CBE 85.3452%-102 - C7 -1UCN 6.4 NDKA_HUMAN
69 PsiBlast_CBE 85.2452%-106 - C7 -3BBF 6.3 NDKB_HUMAN
68 PsiBlast_CBE 85.1152%-107 - C7 -3BBF 6.1 NDKB_HUMAN
62 PsiBlast_CBE 85.0954% -98 - C7 -2HVD 6.7 NDKA_HUMAN
70 PsiBlast_CBE 84.8152%-107 - C7 -3BBF 6.7 NDKB_HUMAN
67 PsiBlast_CBE 84.8152%-103 - C7 -3BBF 6.4 NDKB_HUMAN
83 PsiBlast_CBE 84.7953% -96 - C7 -2HVE 6.7 NDKA_HUMAN
5 PsiBlast_PDB 84.7062%-104 - C7 -3Q86 5.8 NDK_STAAC
63 PsiBlast_CBE 84.6354%-104 - C7 -2HVD 6.4 NDKA_HUMAN
16 PsiBlast_PDB 84.6359%-122 - C7 -1WKK 4.8 NDK_THET8
50 PsiBlast_CBE 84.4653%-117 - C7 -1ZS6 6.4 NDK3_HUMAN
74 PsiBlast_CBE 84.3352%-105 - C7 -3BBB 4.3 NDKB_HUMAN
90 PsiBlast_CBE 84.2853%-106 - C7 -4UOF 6.6 ?
97 PsiBlast_CBE 84.2652%-106 - C7 -1UCN 5.8 NDKA_HUMAN
87 PsiBlast_CBE 84.2353%-108 - C7 -4UOG 6.0 ?
95 PsiBlast_CBE 83.9352%-100 - C7 -1UCN 5.3 NDKA_HUMAN
49 PsiBlast_CBE 83.7053%-110 - C7 -1ZS6 6.5 NDK3_HUMAN
71 PsiBlast_CBE 83.6552%-104 - C7 -3BBF 7.0 NDKB_HUMAN
66 PsiBlast_CBE 83.6552%-103 - C7 -3BBF 6.3 NDKB_HUMAN
53 PsiBlast_CBE 83.6455%-100 - C7 -1BHN 6.1 NDKA1_BOVIN
98 PsiBlast_CBE 83.5859%-111 - C7 -2BEF 7.0 NDKC_DICDI
100 PsiBlast_CBE 83.4959%-105 - C7 -2BEF 7.3 NDKC_DICDI
57 PsiBlast_CBE 83.4654%-104 - C7 -1BE4 5.7 NDKA2_BOVIN
55 PsiBlast_CBE 83.4555% -96 - C7 -1BHN 8.9 NDKA1_BOVIN
54 PsiBlast_CBE 83.3455%-102 - C7 -1BHN 7.4 NDKA1_BOVIN
86 PsiBlast_CBE 83.2753%-105 - C7 -4UOH 6.6 ?
58 PsiBlast_CBE 83.1854%-104 - C7 -1BE4 4.9 NDKA2_BOVIN
110 HHSearch 83.1354% -87 - C7 -4FKX 6.3 ?
14 PsiBlast_PDB 82.8553%-113 - C7 -1ZS6 6.8 NDK3_HUMAN
91 PsiBlast_CBE 82.8253%-105 - C7 -4UOF 6.0 ?
85 PsiBlast_CBE 82.7153%-107 - C7 -4UOH 6.4 ?
88 PsiBlast_CBE 82.5753%-104 - C7 -4UOG 5.6 ?
73 PsiBlast_CBE 82.5752%-102 - C7 -3BBB 3.5 NDKB_HUMAN
92 PsiBlast_CBE 82.5153%-102 - C7 -4UOF 6.6 ?
75 PsiBlast_CBE 82.5052%-103 - C7 -3BBB 3.7 NDKB_HUMAN
108 HHSearch 82.4753%-113 - C7 -1ZS6 6.8 NDK3_HUMAN
99 PsiBlast_CBE 82.4459%-112 - C7 -2BEF 6.6 NDKC_DICDI
72 PsiBlast_CBE 82.1852%-101 - C7 -3BBB 5.3 NDKB_HUMAN
119 HHSearch 78.2347% -94 - C7 -1NHK 5.6 NDK_MYXXA