@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22770: (2016-07-05 )
MNQKHSSDFVVIKAVEDGVNVIGLTRGTDTKFHHSEKLDKGEVIIAQFTEHTSAIKVRGEALIQTAYGEMKSEKK

Atome Classification :

(66 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TRP_B_5(2EXS)
MTRB_GEOSE
[Raw transfer]




TRP_B_14(1QAW)
MTRB_GEOSE
[Raw transfer]




TRP_E_15(3ZZQ)
MTRB_BACSU
[Raw transfer]




TRP_D_20(2ZP8)
MTRB_GEOSE
[Raw transfer]




TRP_C_11(3ZZQ)
MTRB_BACSU
[Raw transfer]




TRP_F_17(3ZZQ)
MTRB_BACSU
[Raw transfer]




TRP_B_9(3ZZQ)
MTRB_BACSU
[Raw transfer]




TRP_B_18(2ZP8)
MTRB_GEOSE
[Raw transfer]




TRP_A_21(2ZP9)
MTRB_GEOSE
[Raw transfer]




TRP_H_18(3ZZS)
MTRB_GEOSE
[Raw transfer]




TRP_G_18(1QAW)
MTRB_GEOSE
[Raw transfer]




TRP_C_19(2ZP8)
MTRB_GEOSE
[Raw transfer]




TRP_E_17(1QAW)
MTRB_GEOSE
[Raw transfer]




TRP_C_8(3ZZL)
MTRB_BACHD
[Raw transfer]




TRP_H_18(3ZZS)
MTRB_GEOSE
[Raw transfer]




TRP_B_6(3ZZL)
MTRB_BACHD
[Raw transfer]




TRP_B_11(3ZZS)
MTRB_GEOSE
[Raw transfer]




TRP_K_12(1QAW)
MTRB_GEOSE
[Raw transfer]




TRP_B_11(3ZZS)
MTRB_GEOSE
[Raw transfer]




TRP_C_15(1QAW)
MTRB_GEOSE
[Raw transfer]




TRP_D_16(1QAW)
MTRB_GEOSE
[Raw transfer]




TRP_D_13(3ZZQ)
MTRB_BACSU
[Raw transfer]




TRP_H_20(1QAW)
MTRB_GEOSE
[Raw transfer]




TRP_F_17(3ZZQ)
MTRB_BACSU
[Raw transfer]




TRP_B_5(2EXS)
MTRB_GEOSE
[Raw transfer]




TRP_I_21(1QAW)
MTRB_GEOSE
[Raw transfer]




TRP_J_22(1QAW)
MTRB_GEOSE
[Raw transfer]




TRP_M_13(2EXT)
MTRB_GEOSE
[Raw transfer]




TRP_M_13(2EXT)
MTRB_GEOSE
[Raw transfer]




TRP_B_8(2ZCZ)
MTRB_GEOSE
[Raw transfer]




TRP_A_4(2ZD0)
MTRB_GEOSE
[Raw transfer]




TRP_B_5(2ZD0)
MTRB_GEOSE
[Raw transfer]




TRP_G_19(1QAW)
MTRB_GEOSE
[Raw transfer]




TRP_F_12(2ZCZ)
MTRB_GEOSE
[Raw transfer]




TRP_E_11(2ZCZ)
MTRB_GEOSE
[Raw transfer]




TRP_C_9(2ZCZ)
MTRB_GEOSE
[Raw transfer]




TRP_B_22(2ZP9)
MTRB_GEOSE
[Raw transfer]




TRP_D_10(4B27)
MTRB_BACSU
[Raw transfer]




TRP_F_12(4B27)
MTRB_BACSU
[Raw transfer]




TRP_E_11(4B27)
MTRB_BACSU
[Raw transfer]




TRP_B_8(4B27)
MTRB_BACSU
[Raw transfer]




TRP_C_9(4B27)
MTRB_BACSU
[Raw transfer]




TRP_G_24(2ZP9)
MTRB_GEOSE
[Raw transfer]




TRP_F_23(2ZP9)
MTRB_GEOSE
[Raw transfer]




TRP_F_12(4B27)
MTRB_BACSU
[Raw transfer]




TRP_L_26(2ZP9)
MTRB_GEOSE
[Raw transfer]




TRP_F_12(2ZCZ)
MTRB_GEOSE
[Raw transfer]




TRP_C_8(3ZZL)
MTRB_BACHD
[Raw transfer]




TRP_C_9(2ZCZ)
MTRB_GEOSE
[Raw transfer]




TRP_D_20(2ZP8)
MTRB_GEOSE
[Raw transfer]




TRP_K_12(1QAW)
MTRB_GEOSE
[Raw transfer]




TRP_K_25(2ZP9)
MTRB_GEOSE
[Raw transfer]




TRP_C_6(2ZD0)
MTRB_GEOSE
[Raw transfer]




TRP_B_5(2EXS)
MTRB_GEOSE
[Raw transfer]




TRP_M_13(2EXT)
MTRB_GEOSE
[Raw transfer]




72 PsiBlast_CBE 81.38100% -94 - C16 -3ZZQ 3.9 MTRB_BACSU
4 PsiBlast_PDB 80.41100% -87 - C16 -3ZZQ 4.0 MTRB_BACSU
70 PsiBlast_CBE 80.23100% -84 - C16 -3ZZQ 3.8 MTRB_BACSU
22 PsiBlast_CBE 79.42100% -56 - C16 -1WAP - MTRB_BACSU -
39 PsiBlast_CBE 79.23100% -70 - C16 -1WAP - MTRB_BACSU -
46 PsiBlast_CBE 79.1798%-115 - C16 -4B27 3.4 MTRB_BACSU
40 PsiBlast_CBE 79.05100% -74 - C16 -1WAP - MTRB_BACSU -
42 PsiBlast_CBE 78.9898%-112 - C16 -4B27 3.4 MTRB_BACSU
43 PsiBlast_CBE 78.8198%-104 - C16 -4B27 3.5 MTRB_BACSU
32 PsiBlast_CBE 78.70100% -71 - C16 -1WAP - MTRB_BACSU -
44 PsiBlast_CBE 78.5098%-109 - C16 -4B27 2.5 MTRB_BACSU
45 PsiBlast_CBE 78.2998%-108 - C16 -4B27 2.6 MTRB_BACSU
191 Fugue 78.24100% -62 - C16 -1WAP - MTRB_BACSU -
190 Fugue 78.24100% -62 - C16 -1WAP - MTRB_BACSU -
1 PsiBlast_PDB 78.24100% -62 - C16 -1WAP - MTRB_BACSU -
2 PsiBlast_PDB 78.1998%-117 - C16 -4B27 3.4 MTRB_BACSU
41 PsiBlast_CBE 78.00100% -53 - C16 -1WAP - MTRB_BACSU -
21 PsiBlast_CBE 77.90100% -68 - C16 -1WAP - MTRB_BACSU -
66 PsiBlast_CBE 77.4286% -63 - C16 -3ZTE - ? -
58 PsiBlast_CBE 76.8886% -56 - C16 -3ZTE - ? -
87 PsiBlast_CBE 76.8081% -69 - C16 -2ZCZ 3.7 MTRB_GEOSE
187 PsiBlast_CBE 76.3375% -71 - C16 -3ZZL 3.8 MTRB_BACHD
15 PsiBlast_PDB 75.8081% -63 - C16 -2ZCZ 3.7 MTRB_GEOSE
120 PsiBlast_CBE 75.5481% -65 - C16 -1QAW 3.9 MTRB_GEOSE
118 PsiBlast_CBE 75.4381% -59 - C16 -1QAW 3.4 MTRB_GEOSE
13 PsiBlast_PDB 75.2681% -72 - C16 -2ZP8 3.6 MTRB_GEOSE
119 PsiBlast_CBE 75.1781% -52 - C16 -1QAW 3.6 MTRB_GEOSE
73 PsiBlast_CBE 75.0981% -84 - C16 -2ZD0 4.2 MTRB_GEOSE
186 PsiBlast_CBE 74.9875% -71 - C16 -3ZZL 3.6 MTRB_BACHD
84 PsiBlast_CBE 74.9681% -57 - C16 -2ZP8 3.7 MTRB_GEOSE
113 PsiBlast_CBE 74.9181% -72 - C16 -1QAW 3.6 MTRB_GEOSE
86 PsiBlast_CBE 74.8681% -67 - C16 -2ZCZ 3.8 MTRB_GEOSE
75 PsiBlast_CBE 74.8581% -84 - C16 -2EXT 3.8 MTRB_GEOSE
88 PsiBlast_CBE 74.8081% -80 - C16 -2ZCZ 3.5 MTRB_GEOSE
89 PsiBlast_CBE 74.7381% -67 - C16 -2ZCZ 3.9 MTRB_GEOSE
82 PsiBlast_CBE 74.6381% -50 - C16 -2ZP8 3.3 MTRB_GEOSE
85 PsiBlast_CBE 74.6281% -88 - C16 -2ZCZ 3.4 MTRB_GEOSE
117 PsiBlast_CBE 74.4881% -54 - C16 -1QAW 3.7 MTRB_GEOSE
83 PsiBlast_CBE 74.4581% -56 - C16 -2ZP8 3.8 MTRB_GEOSE
71 PsiBlast_CBE 74.45100% -86 - C16 -3ZZQ 4.9 MTRB_BACSU
17 PsiBlast_PDB 74.3775% -77 - C16 -3ZZL 3.9 MTRB_BACHD
68 PsiBlast_CBE 74.32100% -83 - C16 -3ZZQ 3.9 MTRB_BACSU
76 PsiBlast_CBE 74.2381% -80 - C16 -2EXT 6.3 MTRB_GEOSE
5 PsiBlast_PDB 74.1281% -93 - C16 -2EXS 3.4 MTRB_GEOSE
115 PsiBlast_CBE 74.1081% -66 - C16 -1QAW 3.8 MTRB_GEOSE
185 PsiBlast_CBE 74.0881% -79 - C16 -2EXS 6.6 MTRB_GEOSE
189 PsiBlast_CBE 74.0687% -89 - C16 -3ZZS 4.0 MTRB_GEOSE
8 PsiBlast_PDB 74.0581% -71 - C16 -1QAW 3.7 MTRB_GEOSE
112 PsiBlast_CBE 74.0481% -68 - C16 -1QAW 3.5 MTRB_GEOSE
184 PsiBlast_CBE 73.8681% -82 - C16 -2EXS 4.1 MTRB_GEOSE
74 PsiBlast_CBE 73.8181% -84 - C16 -2ZD0 3.7 MTRB_GEOSE
188 PsiBlast_CBE 73.6987% -96 - C16 -3ZZS 3.5 MTRB_GEOSE
111 PsiBlast_CBE 73.5881% -63 - C16 -1QAW 3.2 MTRB_GEOSE
114 PsiBlast_CBE 73.5281% -51 - C16 -1QAW 3.4 MTRB_GEOSE
80 PsiBlast_CBE 73.4881% -91 - C16 -2ZP9 3.9 MTRB_GEOSE
116 PsiBlast_CBE 73.3081% -64 - C16 -1QAW 3.7 MTRB_GEOSE
79 PsiBlast_CBE 73.2881% -87 - C16 -2ZP9 4.1 MTRB_GEOSE
7 PsiBlast_PDB 73.1581% -81 - C16 -2EXT 6.4 MTRB_GEOSE
77 PsiBlast_CBE 72.7981% -88 - C16 -2ZP9 4.4 MTRB_GEOSE
81 PsiBlast_CBE 72.7681% -90 - C16 -2ZP9 2.9 MTRB_GEOSE
16 PsiBlast_PDB 72.7581% -82 - C16 -2ZP9 2.6 MTRB_GEOSE
6 PsiBlast_PDB 72.6481% -88 - C16 -2ZD0 3.7 MTRB_GEOSE
78 PsiBlast_CBE 71.3381% -73 - C16 -2ZP9 2.9 MTRB_GEOSE
202 HHSearch 69.1583% -79 * C16 *3ZZS 4.9 MTRB_GEOSE
18 PsiBlast_PDB 68.9187% -83 - C16 -3ZZS 4.9 MTRB_GEOSE
69 PsiBlast_CBE 68.77100% -74 - C16 -3ZZQ 4.9 MTRB_BACSU