@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22780: (2016-07-05 )
MKEVNKEQIEQAVRQILEAIGEDPNREGLLDTPKRVAKMYAEVFSGLNEDPKEHFQTIFGENHEELVLVKDIAFHSMCEHHLVPFYGKAHVAYIPRGGKVTGLSKLARAVEAVAKRPQLQERITSTIAESIVETLDPHGVMVVVEAEHMCMTMRGVRKPGAKTVTSAVRGVFKDDAAARAEVLEHIKRQD

Atome Classification :

(31 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

8DG_C_12(1WUR)
?
[Raw transfer]




8GT_D_14(1WUQ)
?
[Raw transfer]




8DG_A_11(1WUR)
?
[Raw transfer]




8GT_C_12(1WUQ)
?
[Raw transfer]




8GT_C_13(1WUQ)
?
[Raw transfer]




8DG_D_13(1WUR)
?
[Raw transfer]




8DG_A_11(1WUR)
?
[Raw transfer]




8GT_A_11(1WUQ)
?
[Raw transfer]




8DG_D_14(1WUR)
?
[Raw transfer]




8GT_A_15(1WUQ)
?
[Raw transfer]




8DG_A_15(1WUR)
?
[Raw transfer]




GTP_B_11(4DU6)
GCH1_YERPE
[Raw transfer]




GTP_E_24(4DU6)
GCH1_YERPE
[Raw transfer]




GTP_D_20(4DU6)
GCH1_YERPE
[Raw transfer]




GTP_A_6(4DU6)
GCH1_YERPE
[Raw transfer]




GTP_C_14(4DU6)
GCH1_YERPE
[Raw transfer]




IPA_D_14(1FB1)
GCH1_HUMAN
[Raw transfer]




IPA_B_12(1FB1)
GCH1_HUMAN
[Raw transfer]




IPA_D_13(1FB1)
GCH1_HUMAN
[Raw transfer]




IPA_B_11(1FB1)
GCH1_HUMAN
[Raw transfer]




IPA_A_15(1FB1)
GCH1_HUMAN
[Raw transfer]




IPA_B_11(1FB1)
GCH1_HUMAN
[Raw transfer]




1 PsiBlast_PDB 91.9467%-122 - C13 -4UQF - GCH1_LISMO -
166 HHSearch 91.8667%-120 - C13 -4UQF - GCH1_LISMO -
54 PsiBlast_CBE 79.1549% -60 - C13 -1WUR 5.4 ?
53 PsiBlast_CBE 79.0549% -61 - C13 -1WUR 5.4 ?
58 PsiBlast_CBE 78.5149% -58 - C13 -1WUQ 5.1 ?
8 PsiBlast_PDB 78.4849% -63 - C13 -1WUR 5.3 ?
52 PsiBlast_CBE 78.2649% -62 - C13 -1WUR 5.1 ?
56 PsiBlast_CBE 78.2549% -63 - C13 -1WUQ 4.8 ?
169 HHSearch 78.1949% -64 - C13 -1WUR 5.3 ?
62 PsiBlast_CBE 78.1349% -58 - C13 -1WM9 - ? -
55 PsiBlast_CBE 78.0249% -61 - C13 -1WUR 5.2 ?
60 PsiBlast_CBE 77.8449% -58 - C13 -1WM9 - ? -
63 PsiBlast_CBE 77.7549% -53 - C13 -1WM9 - ? -
57 PsiBlast_CBE 77.5949% -61 - C13 -1WUQ 4.9 ?
61 PsiBlast_CBE 77.3649% -55 - C13 -1WM9 - ? -
167 HHSearch 77.2351% 0 - C- -1IS8 - GCH1_RAT -
59 PsiBlast_CBE 77.0949% -58 - C13 -1WUQ 5.1 ?
7 PsiBlast_PDB 77.0949% -61 - C13 -1WUQ 5.1 ?
6 PsiBlast_PDB 76.9749% -56 - C13 -1WM9 - ? -
34 PsiBlast_CBE 74.2049% 0 - C- -1IS8 - GCH1_RAT -
24 PsiBlast_CBE 71.8150% -10 - C13 -1FB1 3.5 GCH1_HUMAN
21 PsiBlast_CBE 71.3650% -3 - C13 -1FB1 3.5 GCH1_HUMAN
180 Fugue 71.3449% -1 - C13 -1FB1 3.8 GCH1_HUMAN
9 PsiBlast_PDB 71.0338% -11 - C13 -4DU6 4.7 GCH1_YERPE
2 PsiBlast_PDB 70.9950% -7 - C13 -1FB1 3.8 GCH1_HUMAN
64 PsiBlast_CBE 70.6638% -4 - C13 -4DU6 4.5 GCH1_YERPE
22 PsiBlast_CBE 70.3750% -3 - C13 -1FB1 3.4 GCH1_HUMAN
66 PsiBlast_CBE 70.3038% -13 - C13 -4DU6 4.1 GCH1_YERPE
65 PsiBlast_CBE 70.2138% -14 - C13 -4DU6 4.2 GCH1_YERPE
67 PsiBlast_CBE 70.0538% -10 - C13 -4DU6 4.6 GCH1_YERPE
23 PsiBlast_CBE 69.5850% -8 - C13 -1FB1 3.6 GCH1_HUMAN