@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22790: (2016-07-05 )
MNKTELINAVAEASELSKKDATKAVDSVFDTILDALKNGDKIQLIGFGNFEVRERSARKGRNPQTGEEIEIPASKVPAFKPGKALKDAVAGK

Atome Classification :

(36 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_D_2(1OUZ)
IHFB_ECOLI
[Raw transfer]

-

NACID_D_2(1OWF)
IHFB_ECOLI
[Raw transfer]

-

NACID_D_2(1OWF)
IHFB_ECOLI
[Raw transfer]

-

NACID_F_2(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(2HT0)
IHFA_ECOLI
[Raw transfer]

-

NACID_I_3(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1P78)
DBH_NOSS1
[Raw transfer]

-

NACID_D_4(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_D_4(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_E_3(2IIE)

[Raw transfer]

-

NACID_D_2(1OWF)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(1OWF)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(1OWG)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(2IIF)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(2HT0)
IHFB_ECOLI
[Raw transfer]

-

NACID_F_2(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_E_3(1OWG)
IHFB_ECOLI
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

NACID_I_3(1P51)
DBH_NOSS1
[Raw transfer]

-

NACID_D_4(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_E_3(2IIE)
IHFA_ECOLI
[Raw transfer]

-

NACID_E_3(2IIE)
IHFA_ECOLI
[Raw transfer]

-

NACID_E_3(1IHF)
IHFB_ECOLI
[Raw transfer]

-

NACID_C_3(4QJU)
DBH_STAAM
[Raw transfer]

-

NACID_D_2(1P78)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1OUZ)
IHFA_ECOLI
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

NACID_D_2(1P71)
DBH_NOSS1
[Raw transfer]

-

39 HHSearch 78.8174% -34 - C7 -4QJU 6.3 DBH_STAAM
1 PsiBlast_PDB 78.5387% -23 - C7 -1HUE - DBH_GEOSE -
3 PsiBlast_PDB 77.7975% -53 - C7 -4QJN - DBH_STAAM -
4 PsiBlast_PDB 77.5975% -35 - C7 -4QJU 6.3 DBH_STAAM
57 Fugue 73.9484% -80 * C7 *1HUU - DBH_GEOSE -
21 PsiBlast_CBE 73.8075% -19 - C7 -4QJU 7.2 DBH_STAAM
2 PsiBlast_PDB 73.0787% -58 - C7 -1HUU - DBH_GEOSE -
6 PsiBlast_PDB 67.7165% -41 - C- -3RHI - ? -
29 PsiBlast_CBE 67.1745% -43 - C7 -4PT4 - DBH_MYCTO (first) -
27 PsiBlast_CBE 66.7652% -9 - C7 -1P51 4.9 DBH_NOSS1
42 HHSearch 66.2545% -35 - C7 -4PT4 - DBH_MYCTO (first) -
5 PsiBlast_PDB 66.1772% -26 - C7 -5FBM - ? -
10 PsiBlast_PDB 65.6852% -6 - C7 -1P51 4.2 DBH_NOSS1
12 PsiBlast_PDB 65.2752% -15 - C7 -1P78 4.8 DBH_NOSS1
38 HHSearch 65.1252% -4 - C7 -1P71 1128214396763122245304320.0 DBH_NOSS1
26 PsiBlast_CBE 64.7052% -9 - C7 -1P51 5.7 DBH_NOSS1
37 HHSearch 64.6058% -85 - C7 -1MUL - DBHA_ECOLI -
11 PsiBlast_PDB 64.5352% -4 - C7 -1P71 1128214396763122245304320.0 DBH_NOSS1
45 HHSearch 64.0843% -25 - C7 -1OWF 3.0 IHFA_ECOLI
25 PsiBlast_CBE 63.7652% -4 - C7 -1P51 4.3 DBH_NOSS1
48 HHSearch 62.5043% -21 - C7 -2IIE 7.7 IHFA_ECOLI (first)
24 PsiBlast_CBE 62.4052% -12 - C7 -1P71 1128214396763122245304320.0 DBH_NOSS1
28 PsiBlast_CBE 62.0543% -30 - C7 -2HT0 4.3 IHFA_ECOLI
19 PsiBlast_PDB 62.0543% -25 - C7 -1OWF 3.0 IHFA_ECOLI
15 PsiBlast_PDB 62.0543% -16 - C7 -2IIF 2.8 IHFA_ECOLI (first)
23 PsiBlast_CBE 62.0452% -17 - C7 -1P78 4.5 DBH_NOSS1
20 PsiBlast_PDB 61.5343% -21 - C7 -1OWG 2.8 IHFA_ECOLI
16 PsiBlast_PDB 60.7143% -24 - C7 -2IIE 7.7 IHFA_ECOLI (first)
18 PsiBlast_PDB 59.2743% -29 - C7 -1OUZ 2.7 IHFA_ECOLI
41 HHSearch 56.0438% 91 - C7 -1OWF 2.8 IHFB_ECOLI
35 PsiBlast_CBE 54.2339% 94 - C7 -1OWF 2.8 IHFB_ECOLI
34 PsiBlast_CBE 51.6939% 110 - C7 -1IHF 3.6 IHFB_ECOLI
33 PsiBlast_CBE 51.2239% 106 - C7 -1OWG 1128214396763122245304320.0 IHFB_ECOLI
32 PsiBlast_CBE 51.1239% 105 - C7 -2HT0 4.2 IHFB_ECOLI
36 PsiBlast_CBE 50.3039% 101 - C7 -1OUZ 3.5 IHFB_ECOLI
50 HHSearch 38.5637% 57 - C7 -2IIE 3.5