@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu22890: (2016-07-05 )
MEKKLSIAIDGPAAAGKSTVAKIVAEKKSYIYIDTGAMYRAITYAALQENVDLTDEEKLAELLKRTDIELITTKDGQKVFVNGTDVTEAIRTDEISNQVSIAAKHRSVREEMVKRQQQLGEKGGVVMDGRDIGTHVLPNAEVKIFLLASVEERAKRRYEENVKKGFDVNYETLIEEIARRDKLDSEREVSPLRKAEDALEIDTTSLSIQEVADKILEAVEQKSR

Atome Classification :

(29 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CDP_D_4(2CMK)
KCY_ECOLI
[Raw transfer]




C5P_H_8(2H92)
KCY_STAAW
[Raw transfer]




C_H_8(1KDO)
KCY_ECOLI
[Raw transfer]




CAR_F_6(1KDR)
KCY_ECOLI
[Raw transfer]




C5P_I_9(2H92)
KCY_STAAW
[Raw transfer]




C5P_G_7(2H92)
KCY_STAAW
[Raw transfer]




C_E_5(1KDP)
KCY_ECOLI
[Raw transfer]




C_I_9(1KDO)
KCY_ECOLI
[Raw transfer]




CAR_G_7(1KDR)
KCY_ECOLI
[Raw transfer]




C5P_G_7(2H92)
KCY_STAAW
[Raw transfer]




C_F_6(1KDP)
KCY_ECOLI
[Raw transfer]




CDP_A_2(3AKD)
KCY_THET8
[Raw transfer]




C5P_C_9(4DIE)
?
[Raw transfer]




DC_C_3(2FEO)
KCY_ECOLI
[Raw transfer]




DOC_F_6(1KDT)
KCY_ECOLI
[Raw transfer]




C5P_D_11(4DIE)
?
[Raw transfer]




C5P_B_7(4DIE)
?
[Raw transfer]




C5P_A_5(4DIE)
?
[Raw transfer]




DOC_G_7(1KDT)
KCY_ECOLI
[Raw transfer]




ADP_A_3(3AKC)
KCY_THET8
[Raw transfer]




DPO_A_2(3R20)
?
[Raw transfer]




DPO_A_2(3R20)
?
[Raw transfer]




90 Fugue 81.7943%-106 - C2 -1CKE - KCY_ECOLI -
100 HHSearch 81.0844%-107 - C2 -1CKE - KCY_ECOLI -
103 HHSearch 79.8441%-115 - C2 -4E22 - KCY_YERPY -
1 PsiBlast_PDB 78.6254% -20 - C2 -1Q3T - KCY_STRPN -
10 PsiBlast_PDB 77.9144%-113 - C2 -1CKE - KCY_ECOLI -
11 PsiBlast_PDB 77.3544%-116 - C2 -2FEM - KCY_ECOLI -
13 PsiBlast_PDB 76.8143%-119 - C2 -4E22 - KCY_YERPY -
9 PsiBlast_PDB 76.6844% -99 - C2 -1KDT 6.0 KCY_ECOLI
101 HHSearch 76.5643% -47 * C2 *3R20 2.9 ?
8 PsiBlast_PDB 76.4144% -94 - C2 -1KDR 5.3 KCY_ECOLI
5 PsiBlast_PDB 76.3544%-108 - C2 -2CMK 5.6 KCY_ECOLI
24 PsiBlast_CBE 76.2543% -46 - C2 -4DIE 5.5 ?
27 PsiBlast_CBE 76.0944% -98 - C2 -1KDR 5.1 KCY_ECOLI
28 PsiBlast_CBE 76.0644%-103 - C2 -1KDP 5.9 KCY_ECOLI
29 PsiBlast_CBE 74.8644%-100 - C2 -1KDO 8.3 KCY_ECOLI
14 PsiBlast_PDB 74.7542% -48 - C2 -3R20 2.9 ?
26 PsiBlast_CBE 74.5844% -99 - C2 -1KDT 5.1 KCY_ECOLI
6 PsiBlast_PDB 74.4444% -93 - C2 -1KDO 8.2 KCY_ECOLI
7 PsiBlast_PDB 74.1944% -93 - C2 -1KDP 7.6 KCY_ECOLI
12 PsiBlast_PDB 71.4444%-101 - C2 -2FEO 4.2 KCY_ECOLI
4 PsiBlast_PDB 71.0543% -55 - C2 -4DIE 5.2 ?
25 PsiBlast_CBE 70.0543% -53 - C2 -4DIE 6.0 ?
104 HHSearch 69.7950% 4 - C2 -2H92 8.0 KCY_STAAW
2 PsiBlast_PDB 69.6250% 3 - C2 -2H92 8.0 KCY_STAAW
21 PsiBlast_CBE 69.3050% 5 - C2 -2H92 9.0 KCY_STAAW
23 PsiBlast_CBE 69.1943% -55 - C2 -4DIE 5.5 ?
22 PsiBlast_CBE 68.6150% 4 - C2 -2H92 8.1 KCY_STAAW
16 PsiBlast_PDB 66.9634%-106 - C2 -3AKD 7.6 KCY_THET8
15 PsiBlast_PDB 65.6034% -87 - C2 -3AKC 7.6 KCY_THET8