@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu23270: (2016-07-06 )
MFTGIIEETGTIESMKKAGHAMALTIKCSKILEDVHLGDSIAVNGICLTVTDFTKNQFTVDVMPETVKATSLNDLTKGSKVNLERAMAANGRFGGHFVSGHVDGTAEITRIEEKSNAVYYDLKMDPSLTKTLVLKGSITVDGVSLTIFGLTEDTVTISLIPHTISETIFSEKTIGSKVNIECDMIGKYMYRFLHKANENKTQQTITKAFLSENGF

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

INI_B_6(4GQN)
RISA_BRUA2
[Raw transfer]




INI_C_8(4GQN)
RISA_BRUA2
[Raw transfer]




CRM_A_4(1KZL)
RISA_SCHPO
[Raw transfer]




CRM_A_4(1KZL)
RISA_SCHPO
[Raw transfer]




RS3_B_6(4G6I)
RISA_BRUA2
[Raw transfer]




RS3_A_4(4G6I)
RISA_BRUA2
[Raw transfer]




RS3_C_7(4G6I)
RISA_BRUA2
[Raw transfer]




RBF_A_4(4E0F)
RISA_BRUA2
[Raw transfer]




CRM_A_4(1KZL)
RISA_SCHPO
[Raw transfer]




INI_B_7(4GQN)
RISA_BRUA2
[Raw transfer]




3 PsiBlast_PDB 84.0335%-113 - C2 -4FXU - RISA_BRUA2 -
35 HHSearch 82.7542% -12 - C2 -1KZL 6.0 RISA_SCHPO
1 PsiBlast_PDB 82.6842% -12 - C2 -1KZL 6.0 RISA_SCHPO
45 Fugue 78.9933% -28 - C2 -1I8D - RISA_ECOLI -
37 HHSearch 77.6834% -29 - C2 -1I8D - RISA_ECOLI -
24 PsiBlast_CBE 77.1235% -56 - C2 -4G6I 6.9 RISA_BRUA2
36 HHSearch 76.0135% -19 - C2 -4G6I 6.6 RISA_BRUA2
25 PsiBlast_CBE 74.4035% -16 - C2 -4E0F - RISA_BRUA2 -
4 PsiBlast_PDB 74.3035% -20 - C2 -4G6I - RISA_BRUA2 -
22 PsiBlast_CBE 74.1435% -17 - C2 -4GQN 5.0 RISA_BRUA2
5 PsiBlast_PDB 73.9635% -20 - C2 -4GQN 2.5 RISA_BRUA2
21 PsiBlast_CBE 73.4635% -17 - C2 -4GQN 4.9 RISA_BRUA2
23 PsiBlast_CBE 73.4235% -21 - C2 -4G6I 5.5 RISA_BRUA2
2 PsiBlast_PDB 72.3935% -18 - C2 -4E0F 5.0 RISA_BRUA2
6 PsiBlast_PDB 71.8734% -3 - C2 -1I8D - RISA_ECOLI -
38 HHSearch 62.0128% 5 - C2 -3A35 - ? -
39 HHSearch 61.0925% -25 - C2 -3DDY - LUXP_PHOLE -
12 PsiBlast_PDB 59.5325% -18 - C2 -3DDY - LUXP_PHOLE -
10 PsiBlast_PDB 58.9927% 1 - C2 -3A35 - ? -
43 HHSearch 57.7823%-127 - C2 -3A35 - ? -
47 Fugue 57.5339% -25 * C2 *1KZL 2.4 RISA_SCHPO