@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : bsu23360: (2016-07-06 )
MKTGYFLLEDGNKIEFELYPEAAPGTVANFEKLANEGFYDGLTFHRVIPGFVSQGGCPHGTGTGGPGYTIKCETEGNPHTHEAGALSMAHAGKDTGGSQFFIVHEPQPHLNGVHTVFGKVTSGLEFAKNMSNGDVMKEVRVEG

Atome Classification :

(105 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

SFM_D_4(1NMK)
PPIA_HUMAN
[Raw transfer]




EA4_A_2(3RDD)
PPIA_HUMAN
[Raw transfer]




SFM_D_4(1NMK)
PPIA_HUMAN
[Raw transfer]




SFM_C_3(1NMK)
PPIA_HUMAN
[Raw transfer]




SFA_D_4(1YND)
PPIA_HUMAN
[Raw transfer]




SFA_C_3(1YND)
PPIA_HUMAN
[Raw transfer]




E1P_A_2(1W8M)
PPIA_HUMAN
[Raw transfer]




WM3_A_2(4N1R)
PPIA_HUMAN
[Raw transfer]




WM4_A_2(4N1S)
PPIA_HUMAN
[Raw transfer]




LSA_A_3(4N1O)
PPIA_HUMAN
[Raw transfer]




WM1_A_2(4N1P)
PPIA_HUMAN
[Raw transfer]




WM2_A_2(4N1Q)
PPIA_HUMAN
[Raw transfer]




1P3_A_2(1W8L)
PPIA_HUMAN
[Raw transfer]




GOL_D_4(2HQ6)
CWC27_HUMAN
[Raw transfer]




UNU_A_2(4N1N)
PPIA_HUMAN
[Raw transfer]




GOL_D_4(2HQ6)
CWC27_HUMAN
[Raw transfer]




GOL_A_2(4DGD)
PPIA_MACMU
[Raw transfer]




EDO_A_4(4R3F)
?
[Raw transfer]




FMT_D_4(2POE)
?
[Raw transfer]




GOL_C_4(2A2N)

[Raw transfer]




CHAIN_H_8(1M63)
PPIA_HUMAN
[Raw transfer]

-

GOL_A_4(4R3E)
CWC27_HUMAN
[Raw transfer]




CHAIN_H_8(4DGC)
PPIA_MACMU
[Raw transfer]

-

CHAIN_C_2(1CWJ)
PPIA_HUMAN
[Raw transfer]

-

WM1_A_3(4N1P)
PPIA_HUMAN
[Raw transfer]




CHAIN_R_18(2RMB)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_T_20(2RMB)
PPIA_HUMAN
[Raw transfer]

-

WM4_A_3(4N1S)
PPIA_HUMAN
[Raw transfer]




CHAIN_B_2(1VBS)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_D_4(1XQ7)
?
[Raw transfer]

-

CHAIN_E_5(1XQ7)
?
[Raw transfer]

-

CHAIN_P_16(2RMB)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_C_3(1VBT)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_D_4(1ZKF)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_N_14(2RMB)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_C_2(1CWM)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_L_12(2RMB)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_B_2(1FGL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_C_2(1CWO)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_D_4(1VBT)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_C_3(1ZKF)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_P_16(2RMB)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_D_4(2OJU)
PPIL3_HUMAN
[Raw transfer]

-

CHAIN_R_18(2RMB)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_B_2(4DGB)
PPIA_MACMU
[Raw transfer]

-

CHAIN_C_2(1CWK)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_C_2(1CWL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_T_20(2RMA)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_C_3(2OJU)
PPIL3_HUMAN
[Raw transfer]

-

CHAIN_B_2(3CYS)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_B_2(2X7K)
PPIL1_HUMAN
[Raw transfer]

-

CHAIN_R_18(2RMA)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_P_16(2RMA)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_C_2(1CWI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_F_6(1XQ7)
?
[Raw transfer]

-

CHAIN_D_4(1M63)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_B_2(1MIK)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_L_12(2RMA)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_B_2(4HY7)
?
[Raw transfer]

-

CHAIN_N_14(2RMA)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_L_12(2RMA)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_N_14(2RMA)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_L_12(2RMB)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_P_16(2RMA)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_T_20(2RMA)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_T_20(2RMB)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_B_2(2X7K)
PPIL1_HUMAN
[Raw transfer]

-

CHAIN_R_18(2RMA)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_D_4(1MF8)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_N_14(2RMB)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_G_7(4DGC)
PPIA_MACMU
[Raw transfer]

-

CHAIN_P_16(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_R_18(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_T_20(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_B_2(4IPZ)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_L_12(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_T_20(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_J_10(4DGC)
PPIA_MACMU
[Raw transfer]

-

CHAIN_P_16(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_P_16(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_F_6(4DGC)
PPIA_MACMU
[Raw transfer]

-

CHAIN_L_12(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_R_18(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_N_14(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_N_14(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_T_20(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_N_14(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_P_16(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_N_14(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_J_10(4DGC)
PPIA_MACMU
[Raw transfer]

-

CHAIN_L_12(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_L_12(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_T_20(3ODI)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_R_18(3ODL)
PPIA_HUMAN
[Raw transfer]

-

CHAIN_R_18(3ODL)
PPIA_HUMAN
[Raw transfer]

-

SFA_D_4(1YND)
PPIA_HUMAN
[Raw transfer]




1 PsiBlast_PDB 96.2975% -77 - C5 -2MVZ - ? -
101 HHSearch 91.2074% -43 - C5 -2MVZ - ? -
115 HHSearch 71.2644% -15 - C5 -1W74 - PPIA_MYCTU -
109 HHSearch 70.8242% -33 - C5 -2A2N - PPWD1_HUMAN -
111 HHSearch 69.0539% -8 - C5 -2HQ6 2.2 CWC27_HUMAN
106 HHSearch 68.2537% -5 - C5 -2POE 2.9 ?
104 HHSearch 67.4135% -35 - C5 -2FU0 - ? -
21 PsiBlast_CBE 67.2444% -31 - C5 -2A2N 2.9
108 HHSearch 67.1241% -14 - C5 -2B71 - ? -
116 HHSearch 66.9737% -7 - C5 -1V9T - PPIA_ECOLI -
6 PsiBlast_PDB 66.8544% -30 - C5 -2A2N - PPWD1_HUMAN -
117 HHSearch 66.8040% -10 - C5 -2OK3 - PPIL3_HUMAN -
2 PsiBlast_PDB 66.7546% -22 - C5 -2B71 - ? -
9 PsiBlast_PDB 66.7144% -11 - C5 -1XYH - PPIL3_HUMAN -
103 HHSearch 66.6440% -28 - C5 -2X7K 7.4 PPIL1_HUMAN
107 HHSearch 65.8138% -17 - C5 -1ZKC - PPIL2_HUMAN -
4 PsiBlast_PDB 65.1148% -33 - C5 -2X7K 7.4 PPIL1_HUMAN
22 PsiBlast_CBE 65.0244% -9 - C5 -2OJU 6.6 PPIL3_HUMAN
10 PsiBlast_PDB 64.4744% -11 - C5 -2OK3 - PPIL3_HUMAN -
110 HHSearch 63.8237% -6 - C5 -4R3F 2.3 ?
11 PsiBlast_PDB 63.8144% -20 - C5 -2HQ6 2.2 CWC27_HUMAN
29 PsiBlast_CBE 63.8045% -6 - C5 -4HY7 7.5 ?
8 PsiBlast_PDB 63.5844% -9 - C5 -2OJU 7.0 PPIL3_HUMAN
88 PsiBlast_CBE 62.6741% 38 - C5 -1NMK 8.0 PPIA_HUMAN
7 PsiBlast_PDB 62.1944% -17 - C5 -4R3E 2.6 CWC27_HUMAN
89 PsiBlast_CBE 61.2741% 39 - C5 -1NMK 8.2 PPIA_HUMAN
63 PsiBlast_CBE 61.1941% 40 - C5 -2RMB 8.1 PPIA_HUMAN
31 PsiBlast_CBE 61.1741% 47 - C5 -4N1S 3.3 PPIA_HUMAN
82 PsiBlast_CBE 60.9541% 39 - C5 -1YND 9.6 PPIA_HUMAN
37 PsiBlast_CBE 60.8241% 46 - C5 -4IPZ 8.0 PPIA_HUMAN
98 PsiBlast_CBE 60.8141% 44 * C5 *1CWK 8.1 PPIA_HUMAN
70 PsiBlast_CBE 60.7941% 39 - C5 -2RMA 8.1 PPIA_HUMAN
60 PsiBlast_CBE 60.7541% 42 - C5 -2RMB 8.2 PPIA_HUMAN
96 PsiBlast_CBE 60.7141% 41 - C5 -1CWM 7.0 PPIA_HUMAN
25 PsiBlast_CBE 60.4342% 43 - C5 -4DGC 7.3 PPIA_MACMU
34 PsiBlast_CBE 60.3441% 43 - C5 -4N1P 2.7 PPIA_HUMAN
93 PsiBlast_CBE 60.2241% 41 - C5 -1M63 6.8 PPIA_HUMAN
90 PsiBlast_CBE 60.1941% 41 - C5 -1MIK 7.9 PPIA_HUMAN
81 PsiBlast_CBE 59.9041% 42 - C5 -1YND 9.7 PPIA_HUMAN
40 PsiBlast_CBE 59.8741% 44 - C5 -3ODL 8.2 PPIA_HUMAN
99 PsiBlast_CBE 59.7841% 42 - C5 -1CWJ 7.7 PPIA_HUMAN
45 PsiBlast_CBE 59.6541% 45 - C5 -3ODL 2.9 PPIA_HUMAN
18 PsiBlast_PDB 59.6442% 40 - C5 -4DGC 7.1 PPIA_MACMU
80 PsiBlast_CBE 59.5941% 47 - C5 -1ZKF 6.4 PPIA_HUMAN
72 PsiBlast_CBE 59.5541% 46 - C5 -2RMA 7.8 PPIA_HUMAN
77 PsiBlast_CBE 59.5241% 44 - C5 -2RMA 3.0 PPIA_HUMAN
35 PsiBlast_CBE 59.5241% 44 - C5 -4N1O 3.1 PPIA_HUMAN
53 PsiBlast_CBE 59.5141% 39 - C5 -3ODI 2.9 PPIA_HUMAN
95 PsiBlast_CBE 59.5041% 45 - C5 -1CWO 7.2 PPIA_HUMAN
66 PsiBlast_CBE 59.4741% 42 - C5 -2RMB 2.9 PPIA_HUMAN
57 PsiBlast_CBE 59.4541% 45 - C5 -3ODI 2.9 PPIA_HUMAN
94 PsiBlast_CBE 59.4141% 43 - C5 -1FGL 6.9 PPIA_HUMAN
36 PsiBlast_CBE 59.3841% 46 - C5 -4N1N 3.1 PPIA_HUMAN
92 PsiBlast_CBE 59.3441% 43 - C5 -1M63 6.9 PPIA_HUMAN
46 PsiBlast_CBE 59.3141% 42 - C5 -3ODL 2.9 PPIA_HUMAN
68 PsiBlast_CBE 59.3041% 43 - C5 -2RMB 2.9 PPIA_HUMAN
97 PsiBlast_CBE 59.2941% 44 - C5 -1CWL 7.5 PPIA_HUMAN
71 PsiBlast_CBE 59.2941% 40 - C5 -2RMA 7.8 PPIA_HUMAN
39 PsiBlast_CBE 59.2841% 46 - C5 -3ODL 8.0 PPIA_HUMAN
30 PsiBlast_CBE 59.2841% 43 - C5 -3RDD 3.9 PPIA_HUMAN
41 PsiBlast_CBE 59.2541% 43 - C5 -3ODL 7.4 PPIA_HUMAN
75 PsiBlast_CBE 59.2241% 47 - C5 -2RMA 3.0 PPIA_HUMAN
67 PsiBlast_CBE 59.2241% 41 - C5 -2RMB 3.0 PPIA_HUMAN
44 PsiBlast_CBE 59.1441% 45 - C5 -3ODL 2.9 PPIA_HUMAN
76 PsiBlast_CBE 59.1241% 40 - C5 -2RMA 2.9 PPIA_HUMAN
51 PsiBlast_CBE 59.1241% 44 - C5 -3ODI 7.8 PPIA_HUMAN
84 PsiBlast_CBE 59.0841% 44 - C5 -1W8L 3.3 PPIA_HUMAN
78 PsiBlast_CBE 59.0641% 44 - C5 -2RMA 3.0 PPIA_HUMAN
61 PsiBlast_CBE 59.0541% 42 - C5 -2RMB 7.9 PPIA_HUMAN
49 PsiBlast_CBE 59.0441% 45 - C5 -3ODI 7.5 PPIA_HUMAN
50 PsiBlast_CBE 58.9941% 44 - C5 -3ODI 8.0 PPIA_HUMAN
33 PsiBlast_CBE 58.9841% 44 - C5 -4N1Q 3.3 PPIA_HUMAN
73 PsiBlast_CBE 58.9741% 42 - C5 -2RMA 8.0 PPIA_HUMAN
91 PsiBlast_CBE 58.9341% 45 - C5 -1MF8 5.8 PPIA_HUMAN
12 PsiBlast_PDB 58.9042% 37 - C5 -4DGD 1.7 PPIA_MACMU
48 PsiBlast_CBE 58.8641% 47 - C5 -3ODI 7.8 PPIA_HUMAN
100 PsiBlast_CBE 58.8541% 44 - C5 -1CWI 8.3 PPIA_HUMAN
32 PsiBlast_CBE 58.8341% 48 - C5 -4N1R 2.9 PPIA_HUMAN
47 PsiBlast_CBE 58.7541% 47 - C5 -3ODL 3.0 PPIA_HUMAN
42 PsiBlast_CBE 58.7041% 42 - C5 -3ODL 7.6 PPIA_HUMAN
54 PsiBlast_CBE 58.6741% 45 - C5 -3ODI 2.8 PPIA_HUMAN
17 PsiBlast_PDB 58.6342% 40 - C5 -4DGB 3.5 PPIA_MACMU
86 PsiBlast_CBE 58.5241% 46 - C5 -1VBT 5.1 PPIA_HUMAN
64 PsiBlast_CBE 58.5141% 43 - C5 -2RMB 2.9 PPIA_HUMAN
74 PsiBlast_CBE 58.4741% 42 - C5 -2RMA 3.0 PPIA_HUMAN
79 PsiBlast_CBE 58.4541% 47 - C5 -1ZKF 6.1 PPIA_HUMAN
55 PsiBlast_CBE 58.3641% 42 - C5 -3ODI 2.9 PPIA_HUMAN
65 PsiBlast_CBE 58.3241% 45 - C5 -2RMB 3.0 PPIA_HUMAN
83 PsiBlast_CBE 58.2841% 46 - C5 -1W8M 2.9 PPIA_HUMAN
62 PsiBlast_CBE 58.2141% 48 - C5 -2RMB 7.5 PPIA_HUMAN
43 PsiBlast_CBE 58.1941% 47 - C5 -3ODL 3.0 PPIA_HUMAN
56 PsiBlast_CBE 58.1441% 43 - C5 -3ODI 3.0 PPIA_HUMAN
52 PsiBlast_CBE 58.1341% 45 - C5 -3ODI 7.7 PPIA_HUMAN
38 PsiBlast_CBE 58.1241% 45 - C5 -3ODL 7.5 PPIA_HUMAN
85 PsiBlast_CBE 58.0341% 46 - C5 -1VBT 5.5 PPIA_HUMAN
69 PsiBlast_CBE 57.9641% 42 - C5 -2RMA 8.2 PPIA_HUMAN
26 PsiBlast_CBE 57.9442% 41 - C5 -4DGC 6.5 PPIA_MACMU
20 PsiBlast_PDB 57.5742% 32 - C5 -1XQ7 5.9 ?
23 PsiBlast_CBE 57.4842% 39 - C5 -4DGC 7.4 PPIA_MACMU
27 PsiBlast_CBE 57.3842% 27 - C5 -1XQ7 7.0 ?
59 PsiBlast_CBE 57.3141% 38 - C5 -2RMB 8.1 PPIA_HUMAN
28 PsiBlast_CBE 56.8342% 27 - C5 -1XQ7 5.1 ?
87 PsiBlast_CBE 56.8241% 52 - C5 -1VBS 5.5 PPIA_HUMAN
58 PsiBlast_CBE 56.4241% 27 - C5 -3CYS 4.4 PPIA_HUMAN
24 PsiBlast_CBE 55.6642% 38 - C5 -4DGC 3.1 PPIA_MACMU